From patchwork Tue Sep 12 18:39:15 2023 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 7bit X-Patchwork-Submitter: "Rafael J. Wysocki" X-Patchwork-Id: 722445 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on aws-us-west-2-korg-lkml-1.web.codeaurora.org Received: from vger.kernel.org (vger.kernel.org [23.128.96.18]) by smtp.lore.kernel.org (Postfix) with ESMTP id 6E38DEE3F11 for ; Tue, 12 Sep 2023 18:47:53 +0000 (UTC) Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S237640AbjILSr4 (ORCPT ); Tue, 12 Sep 2023 14:47:56 -0400 Received: from lindbergh.monkeyblade.net ([23.128.96.19]:46458 "EHLO lindbergh.monkeyblade.net" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S237545AbjILSry (ORCPT ); Tue, 12 Sep 2023 14:47:54 -0400 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) by lindbergh.monkeyblade.net (Postfix) with ESMTPS id 0D64E1705; Tue, 12 Sep 2023 11:47:41 -0700 (PDT) Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 5.2.0) id 25b387b3422685a1; Tue, 12 Sep 2023 20:47:40 +0200 Authentication-Results: v370.home.net.pl; spf=softfail (domain owner discourages use of this host) smtp.mailfrom=rjwysocki.net (client-ip=195.136.19.94; helo=[195.136.19.94]; envelope-from=rjw@rjwysocki.net; receiver=) Received: from kreacher.localnet (unknown [195.136.19.94]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by v370.home.net.pl (Postfix) with ESMTPSA id CE019663BE5; Tue, 12 Sep 2023 20:47:39 +0200 (CEST) From: "Rafael J. Wysocki" To: Linux ACPI Cc: LKML , Linux PM , Zhang Rui , Srinivas Pandruvada , Daniel Lezcano Subject: [PATCH v1 4/9] ACPI: thermal: Create and populate trip points table earlier Date: Tue, 12 Sep 2023 20:39:15 +0200 Message-ID: <13346091.uLZWGnKmhe@kreacher> In-Reply-To: <5708760.DvuYhMxLoT@kreacher> References: <5708760.DvuYhMxLoT@kreacher> MIME-Version: 1.0 X-CLIENT-IP: 195.136.19.94 X-CLIENT-HOSTNAME: 195.136.19.94 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedviedrudeiiedgudefudcutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfjqffogffrnfdpggftiffpkfenuceurghilhhouhhtmecuudehtdenucesvcftvggtihhpihgvnhhtshculddquddttddmnecujfgurhephffvvefufffkjghfggfgtgesthfuredttddtjeenucfhrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqeenucggtffrrghtthgvrhhnpedvffeuiedtgfdvtddugeeujedtffetteegfeekffdvfedttddtuefhgeefvdejhfenucfkphepudelhedrudefiedrudelrdelgeenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpeduleehrddufeeirdduledrleegpdhhvghlohepkhhrvggrtghhvghrrdhlohgtrghlnhgvthdpmhgrihhlfhhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqpdhnsggprhgtphhtthhopeeipdhrtghpthhtoheplhhinhhugidqrggtphhisehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqkhgvrhhnvghlsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqphhmsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheprhhuihdriihhrghnghesihhnthgvlhdrtghomhdprhgtphhtthhopehs rhhinhhivhgrshdrphgrnhgurhhuvhgruggrsehlihhnuhigrdhinhhtvghlrdgtohhmpdhrtghpthhtohepuggrnhhivghlrdhlvgiitggrnhhosehlihhnrghrohdrohhrgh X-DCC--Metrics: v370.home.net.pl 1024; Body=6 Fuz1=6 Fuz2=6 Precedence: bulk List-ID: X-Mailing-List: linux-pm@vger.kernel.org From: Rafael J. Wysocki Create and populate the driver's trip points table in acpi_thermal_add() so as to allow the its data structures to be simplified going forward. No intentional functional impact. Signed-off-by: Rafael J. Wysocki --- drivers/acpi/thermal.c | 105 ++++++++++++++++++++++++------------------------- 1 file changed, 52 insertions(+), 53 deletions(-) Index: linux-pm/drivers/acpi/thermal.c =================================================================== --- linux-pm.orig/drivers/acpi/thermal.c +++ linux-pm/drivers/acpi/thermal.c @@ -688,53 +688,10 @@ static void acpi_thermal_zone_sysfs_remo } static int acpi_thermal_register_thermal_zone(struct acpi_thermal *tz, - unsigned int trip_count) + unsigned int trip_count, + int passive_delay) { - struct acpi_thermal_trip *acpi_trip; - struct thermal_trip *trip; - int passive_delay = 0; int result; - int i; - - trip = kcalloc(trip_count, sizeof(*trip), GFP_KERNEL); - if (!trip) - return -ENOMEM; - - tz->trip_table = trip; - - if (tz->trips.critical.valid) { - trip->type = THERMAL_TRIP_CRITICAL; - trip->temperature = acpi_thermal_temp(tz, tz->trips.critical.temperature); - trip++; - } - - if (tz->trips.hot.valid) { - trip->type = THERMAL_TRIP_HOT; - trip->temperature = acpi_thermal_temp(tz, tz->trips.hot.temperature); - trip++; - } - - acpi_trip = &tz->trips.passive.trip; - if (acpi_trip->valid) { - passive_delay = tz->trips.passive.tsp * 100; - - trip->type = THERMAL_TRIP_PASSIVE; - trip->temperature = acpi_thermal_temp(tz, acpi_trip->temperature); - trip->priv = acpi_trip; - trip++; - } - - for (i = 0; i < ACPI_THERMAL_MAX_ACTIVE; i++) { - acpi_trip = &tz->trips.active[i].trip; - - if (!acpi_trip->valid) - break; - - trip->type = THERMAL_TRIP_ACTIVE; - trip->temperature = acpi_thermal_temp(tz, acpi_trip->temperature); - trip->priv = acpi_trip; - trip++; - } tz->thermal_zone = thermal_zone_device_register_with_trips("acpitz", tz->trip_table, @@ -744,10 +701,8 @@ static int acpi_thermal_register_thermal NULL, passive_delay, tz->polling_frequency * 100); - if (IS_ERR(tz->thermal_zone)) { - result = PTR_ERR(tz->thermal_zone); - goto free_trip_table; - } + if (IS_ERR(tz->thermal_zone)) + return PTR_ERR(tz->thermal_zone); result = acpi_thermal_zone_sysfs_add(tz); if (result) @@ -766,8 +721,6 @@ remove_links: acpi_thermal_zone_sysfs_remove(tz); unregister_tzd: thermal_zone_device_unregister(tz->thermal_zone); -free_trip_table: - kfree(tz->trip_table); return result; } @@ -886,9 +839,13 @@ static void acpi_thermal_check_fn(struct static int acpi_thermal_add(struct acpi_device *device) { + struct acpi_thermal_trip *acpi_trip; + struct thermal_trip *trip; struct acpi_thermal *tz; unsigned int trip_count; + int passive_delay = 0; int result; + int i; if (!device) return -EINVAL; @@ -930,9 +887,49 @@ static int acpi_thermal_add(struct acpi_ acpi_thermal_guess_offset(tz); - result = acpi_thermal_register_thermal_zone(tz, trip_count); + trip = kcalloc(trip_count, sizeof(*trip), GFP_KERNEL); + if (!trip) + return -ENOMEM; + + tz->trip_table = trip; + + if (tz->trips.critical.valid) { + trip->type = THERMAL_TRIP_CRITICAL; + trip->temperature = acpi_thermal_temp(tz, tz->trips.critical.temperature); + trip++; + } + + if (tz->trips.hot.valid) { + trip->type = THERMAL_TRIP_HOT; + trip->temperature = acpi_thermal_temp(tz, tz->trips.hot.temperature); + trip++; + } + + acpi_trip = &tz->trips.passive.trip; + if (acpi_trip->valid) { + passive_delay = tz->trips.passive.tsp * 100; + + trip->type = THERMAL_TRIP_PASSIVE; + trip->temperature = acpi_thermal_temp(tz, acpi_trip->temperature); + trip->priv = acpi_trip; + trip++; + } + + for (i = 0; i < ACPI_THERMAL_MAX_ACTIVE; i++) { + acpi_trip = &tz->trips.active[i].trip; + + if (!acpi_trip->valid) + break; + + trip->type = THERMAL_TRIP_ACTIVE; + trip->temperature = acpi_thermal_temp(tz, acpi_trip->temperature); + trip->priv = acpi_trip; + trip++; + } + + result = acpi_thermal_register_thermal_zone(tz, trip_count, passive_delay); if (result) - goto free_memory; + goto free_trips; refcount_set(&tz->thermal_check_count, 3); mutex_init(&tz->thermal_check_lock); @@ -951,6 +948,8 @@ static int acpi_thermal_add(struct acpi_ flush_wq: flush_workqueue(acpi_thermal_pm_queue); acpi_thermal_unregister_thermal_zone(tz); +free_trips: + kfree(tz->trip_table); free_memory: kfree(tz);