From patchwork Wed Aug 10 16:14:22 2022 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 7bit X-Patchwork-Submitter: "Rafael J. Wysocki" X-Patchwork-Id: 596445 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on aws-us-west-2-korg-lkml-1.web.codeaurora.org Received: from vger.kernel.org (vger.kernel.org [23.128.96.18]) by smtp.lore.kernel.org (Postfix) with ESMTP id 89B70C25B0C for ; Wed, 10 Aug 2022 16:24:55 +0000 (UTC) Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S230378AbiHJQYZ (ORCPT ); Wed, 10 Aug 2022 12:24:25 -0400 Received: from lindbergh.monkeyblade.net ([23.128.96.19]:52060 "EHLO lindbergh.monkeyblade.net" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S232713AbiHJQYD (ORCPT ); Wed, 10 Aug 2022 12:24:03 -0400 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) by lindbergh.monkeyblade.net (Postfix) with ESMTPS id 788827E834; Wed, 10 Aug 2022 09:24:01 -0700 (PDT) Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 5.0.0) id 628687f6e8a7044b; Wed, 10 Aug 2022 18:23:59 +0200 Received: from kreacher.localnet (unknown [213.134.187.55]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by v370.home.net.pl (Postfix) with ESMTPSA id ED44E66CF1C; Wed, 10 Aug 2022 18:23:58 +0200 (CEST) From: "Rafael J. Wysocki" To: Linux ACPI Cc: LKML , Andy Shevchenko , Linux PM , linux-hwmon@vger.kernel.org, Jean Delvare , Guenter Roeck Subject: [PATCH v1 1/5] ACPI: Rename acpi_bus_get/put_acpi_device() Date: Wed, 10 Aug 2022 18:14:22 +0200 Message-ID: <4763162.31r3eYUQgx@kreacher> In-Reply-To: <12036348.O9o76ZdvQC@kreacher> References: <12036348.O9o76ZdvQC@kreacher> MIME-Version: 1.0 X-CLIENT-IP: 213.134.187.55 X-CLIENT-HOSTNAME: 213.134.187.55 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedvfedrvdegvddgleejucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecujffqoffgrffnpdggtffipffknecuuegrihhlohhuthemucduhedtnecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenucfjughrpefhvfevufffkfgjfhgggfgtsehtufertddttdejnecuhfhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqnecuggftrfgrthhtvghrnhepvdffueeitdfgvddtudegueejtdffteetgeefkeffvdeftddttdeuhfegfedvjefhnecukfhppedvudefrddufeegrddukeejrdehheenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpedvudefrddufeegrddukeejrdehhedphhgvlhhopehkrhgvrggthhgvrhdrlhhotggrlhhnvghtpdhmrghilhhfrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqedpnhgspghrtghpthhtohepjedprhgtphhtthhopehlihhnuhigqdgrtghpihesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopehlihhnuhigqdhkvghrnhgvlhesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopegrnhgurhhihidrshhhvghvtghhvghnkhhosehlihhnuhigrdhinhhtvghlrdgtohhmpdhrtghpthhtoheplhhinhhugidqphhmsehvghgvrhdrkhgvrhhn vghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqhhifmhhonhesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopehjuggvlhhvrghrvgesshhushgvrdgtohhmpdhrtghpthhtoheplhhinhhugiesrhhovggtkhdquhhsrdhnvght X-DCC--Metrics: v370.home.net.pl 1024; Body=7 Fuz1=7 Fuz2=7 Precedence: bulk List-ID: X-Mailing-List: linux-acpi@vger.kernel.org From: Rafael J. Wysocki Because acpi_bus_get_acpi_device() is completely analogous to acpi_fetch_acpi_dev(), rename it to acpi_get_acpi_dev() and add a kerneldoc comment to it. Accordingly, rename acpi_bus_put_acpi_device() to acpi_put_acpi_dev() and update all of the users of these two functions. While at it, move the acpi_fetch_acpi_dev() header next to the acpi_get_acpi_dev() header in the header file holding them. Signed-off-by: Rafael J. Wysocki --- drivers/acpi/bus.c | 6 +++--- drivers/acpi/device_pm.c | 4 ++-- drivers/acpi/irq.c | 4 ++-- drivers/acpi/scan.c | 21 ++++++++++++++++----- drivers/hwmon/acpi_power_meter.c | 2 +- include/acpi/acpi_bus.h | 6 +++--- 6 files changed, 27 insertions(+), 16 deletions(-) Index: linux-pm/include/acpi/acpi_bus.h =================================================================== --- linux-pm.orig/include/acpi/acpi_bus.h +++ linux-pm/include/acpi/acpi_bus.h @@ -511,7 +511,6 @@ extern int unregister_acpi_notifier(stru * External Functions */ -struct acpi_device *acpi_fetch_acpi_dev(acpi_handle handle); acpi_status acpi_bus_get_status_handle(acpi_handle handle, unsigned long long *sta); int acpi_bus_get_status(struct acpi_device *device); @@ -766,9 +765,10 @@ static inline void acpi_dev_put(struct a put_device(&adev->dev); } -struct acpi_device *acpi_bus_get_acpi_device(acpi_handle handle); +struct acpi_device *acpi_fetch_acpi_dev(acpi_handle handle); +struct acpi_device *acpi_get_acpi_dev(acpi_handle handle); -static inline void acpi_bus_put_acpi_device(struct acpi_device *adev) +static inline void acpi_put_acpi_dev(struct acpi_device *adev) { acpi_dev_put(adev); } Index: linux-pm/drivers/acpi/scan.c =================================================================== --- linux-pm.orig/drivers/acpi/scan.c +++ linux-pm/drivers/acpi/scan.c @@ -429,7 +429,7 @@ void acpi_device_hotplug(struct acpi_dev acpi_evaluate_ost(adev->handle, src, ost_code, NULL); out: - acpi_bus_put_acpi_device(adev); + acpi_put_acpi_dev(adev); mutex_unlock(&acpi_scan_lock); unlock_device_hotplug(); } @@ -599,11 +599,22 @@ static void get_acpi_device(void *dev) acpi_dev_get(dev); } -struct acpi_device *acpi_bus_get_acpi_device(acpi_handle handle) +/** + * acpi_get_acpi_dev - Retrieve ACPI device object and reference count it. + * @handle: ACPI handle associated with the requested ACPI device object. + * + * Return a pointer to the ACPI device object associated with @handle and bump + * up that object's reference counter (under the ACPI Namespace lock), if + * present, or return NULL otherwise. + * + * The ACPI device object reference acquired by this function needs to be + * dropped via acpi_dev_put(). + */ +struct acpi_device *acpi_get_acpi_dev(acpi_handle handle) { return handle_to_device(handle, get_acpi_device); } -EXPORT_SYMBOL_GPL(acpi_bus_get_acpi_device); +EXPORT_SYMBOL_GPL(acpi_get_acpi_dev); static struct acpi_device_bus_id *acpi_device_bus_id_match(const char *dev_id) { @@ -2238,7 +2249,7 @@ static int acpi_dev_get_first_consumer_d { struct acpi_device *adev; - adev = acpi_bus_get_acpi_device(dep->consumer); + adev = acpi_get_acpi_dev(dep->consumer); if (adev) { *(struct acpi_device **)data = adev; return 1; @@ -2291,7 +2302,7 @@ static bool acpi_scan_clear_dep_queue(st static int acpi_scan_clear_dep(struct acpi_dep_data *dep, void *data) { - struct acpi_device *adev = acpi_bus_get_acpi_device(dep->consumer); + struct acpi_device *adev = acpi_get_acpi_dev(dep->consumer); if (adev) { adev->dep_unmet--; Index: linux-pm/drivers/acpi/bus.c =================================================================== --- linux-pm.orig/drivers/acpi/bus.c +++ linux-pm/drivers/acpi/bus.c @@ -511,7 +511,7 @@ static void acpi_bus_notify(acpi_handle break; } - adev = acpi_bus_get_acpi_device(handle); + adev = acpi_get_acpi_dev(handle); if (!adev) goto err; @@ -524,14 +524,14 @@ static void acpi_bus_notify(acpi_handle } if (!hotplug_event) { - acpi_bus_put_acpi_device(adev); + acpi_put_acpi_dev(adev); return; } if (ACPI_SUCCESS(acpi_hotplug_schedule(adev, type))) return; - acpi_bus_put_acpi_device(adev); + acpi_put_acpi_dev(adev); err: acpi_evaluate_ost(handle, type, ost_code, NULL); Index: linux-pm/drivers/acpi/device_pm.c =================================================================== --- linux-pm.orig/drivers/acpi/device_pm.c +++ linux-pm/drivers/acpi/device_pm.c @@ -497,7 +497,7 @@ static void acpi_pm_notify_handler(acpi_ acpi_handle_debug(handle, "Wake notify\n"); - adev = acpi_bus_get_acpi_device(handle); + adev = acpi_get_acpi_dev(handle); if (!adev) return; @@ -515,7 +515,7 @@ static void acpi_pm_notify_handler(acpi_ mutex_unlock(&acpi_pm_notifier_lock); - acpi_bus_put_acpi_device(adev); + acpi_put_acpi_dev(adev); } /** Index: linux-pm/drivers/acpi/irq.c =================================================================== --- linux-pm.orig/drivers/acpi/irq.c +++ linux-pm/drivers/acpi/irq.c @@ -111,12 +111,12 @@ acpi_get_irq_source_fwhandle(const struc if (WARN_ON(ACPI_FAILURE(status))) return NULL; - device = acpi_bus_get_acpi_device(handle); + device = acpi_get_acpi_dev(handle); if (WARN_ON(!device)) return NULL; result = &device->fwnode; - acpi_bus_put_acpi_device(device); + acpi_put_acpi_dev(device); return result; } Index: linux-pm/drivers/hwmon/acpi_power_meter.c =================================================================== --- linux-pm.orig/drivers/hwmon/acpi_power_meter.c +++ linux-pm/drivers/hwmon/acpi_power_meter.c @@ -598,7 +598,7 @@ static int read_domain_devices(struct ac continue; /* Create a symlink to domain objects */ - obj = acpi_bus_get_acpi_device(element->reference.handle); + obj = acpi_get_acpi_dev(element->reference.handle); resource->domain_devices[i] = obj; if (!obj) continue; From patchwork Wed Aug 10 16:15:24 2022 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 7bit X-Patchwork-Submitter: "Rafael J. Wysocki" X-Patchwork-Id: 596674 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on aws-us-west-2-korg-lkml-1.web.codeaurora.org Received: from vger.kernel.org (vger.kernel.org [23.128.96.18]) by smtp.lore.kernel.org (Postfix) with ESMTP id 6A29FC19F2A for ; Wed, 10 Aug 2022 16:24:55 +0000 (UTC) Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S232681AbiHJQYY (ORCPT ); Wed, 10 Aug 2022 12:24:24 -0400 Received: from lindbergh.monkeyblade.net ([23.128.96.19]:52022 "EHLO lindbergh.monkeyblade.net" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S232686AbiHJQYB (ORCPT ); Wed, 10 Aug 2022 12:24:01 -0400 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) by lindbergh.monkeyblade.net (Postfix) with ESMTPS id BA94D81B1A; Wed, 10 Aug 2022 09:23:59 -0700 (PDT) Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 5.0.0) id 2ced05b3971ab5bb; Wed, 10 Aug 2022 18:23:58 +0200 Received: from kreacher.localnet (unknown [213.134.187.55]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by v370.home.net.pl (Postfix) with ESMTPSA id 7C19566CF1C; Wed, 10 Aug 2022 18:23:57 +0200 (CEST) From: "Rafael J. Wysocki" To: Linux ACPI Cc: LKML , Andy Shevchenko , Linux PM Subject: [PATCH v1 2/5] ACPI: scan: Rename acpi_bus_get_parent() and rearrange it Date: Wed, 10 Aug 2022 18:15:24 +0200 Message-ID: <2252770.ElGaqSPkdT@kreacher> In-Reply-To: <12036348.O9o76ZdvQC@kreacher> References: <12036348.O9o76ZdvQC@kreacher> MIME-Version: 1.0 X-CLIENT-IP: 213.134.187.55 X-CLIENT-HOSTNAME: 213.134.187.55 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedvfedrvdegvddgleejucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecujffqoffgrffnpdggtffipffknecuuegrihhlohhuthemucduhedtnecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenucfjughrpefhvfevufffkfgjfhgggfgtsehtufertddttdejnecuhfhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqnecuggftrfgrthhtvghrnhepvdffueeitdfgvddtudegueejtdffteetgeefkeffvdeftddttdeuhfegfedvjefhnecukfhppedvudefrddufeegrddukeejrdehheenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpedvudefrddufeegrddukeejrdehhedphhgvlhhopehkrhgvrggthhgvrhdrlhhotggrlhhnvghtpdhmrghilhhfrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqedpnhgspghrtghpthhtohepgedprhgtphhtthhopehlihhnuhigqdgrtghpihesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopehlihhnuhigqdhkvghrnhgvlhesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopegrnhgurhhihidrshhhvghvtghhvghnkhhosehlihhnuhigrdhinhhtvghlrdgtohhmpdhrtghpthhtoheplhhinhhugidqphhmsehvghgvrhdrkhgvrhhn vghlrdhorhhg X-DCC--Metrics: v370.home.net.pl 1024; Body=4 Fuz1=4 Fuz2=4 Precedence: bulk List-ID: X-Mailing-List: linux-acpi@vger.kernel.org From: Rafael J. Wysocki The acpi_bus_get_parent() name doesn't really reflect the purpose of the function so change it to a more accurate acpi_find_parent_acpi_dev(). While at it, rearrange the code inside that function the make it easier to read. No intentional functional impact. Signed-off-by: Rafael J. Wysocki --- drivers/acpi/scan.c | 24 ++++++++++++++---------- 1 file changed, 14 insertions(+), 10 deletions(-) Index: linux-pm/drivers/acpi/scan.c =================================================================== --- linux-pm.orig/drivers/acpi/scan.c +++ linux-pm/drivers/acpi/scan.c @@ -816,10 +816,9 @@ static const char * const acpi_honor_dep NULL }; -static struct acpi_device *acpi_bus_get_parent(acpi_handle handle) +static struct acpi_device *acpi_find_parent_acpi_dev(acpi_handle handle) { - struct acpi_device *device; - acpi_status status; + struct acpi_device *adev; /* * Fixed hardware devices do not appear in the namespace and do not @@ -830,13 +829,18 @@ static struct acpi_device *acpi_bus_get_ return acpi_root; do { - status = acpi_get_parent(handle, &handle); - if (ACPI_FAILURE(status)) - return status == AE_NULL_ENTRY ? NULL : acpi_root; + acpi_status status; - device = acpi_fetch_acpi_dev(handle); - } while (!device); - return device; + status = acpi_get_parent(handle, &handle); + if (ACPI_FAILURE(status)) { + if (status != AE_NULL_ENTRY) + return acpi_root; + + return NULL; + } + adev = acpi_fetch_acpi_dev(handle); + } while (!adev); + return adev; } acpi_status @@ -1777,7 +1781,7 @@ void acpi_init_device_object(struct acpi INIT_LIST_HEAD(&device->pnp.ids); device->device_type = type; device->handle = handle; - device->parent = acpi_bus_get_parent(handle); + device->parent = acpi_find_parent_acpi_dev(handle); fwnode_init(&device->fwnode, &acpi_device_fwnode_ops); acpi_set_device_status(device, ACPI_STA_DEFAULT); acpi_device_get_busid(device); From patchwork Wed Aug 10 16:16:33 2022 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 7bit X-Patchwork-Submitter: "Rafael J. Wysocki" X-Patchwork-Id: 596675 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on aws-us-west-2-korg-lkml-1.web.codeaurora.org Received: from vger.kernel.org (vger.kernel.org [23.128.96.18]) by smtp.lore.kernel.org (Postfix) with ESMTP id 82C75C25B0D for ; Wed, 10 Aug 2022 16:24:24 +0000 (UTC) Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S232537AbiHJQYX (ORCPT ); Wed, 10 Aug 2022 12:24:23 -0400 Received: from lindbergh.monkeyblade.net ([23.128.96.19]:52016 "EHLO lindbergh.monkeyblade.net" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S232673AbiHJQYB (ORCPT ); Wed, 10 Aug 2022 12:24:01 -0400 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) by lindbergh.monkeyblade.net (Postfix) with ESMTPS id 6E3E980F6D; Wed, 10 Aug 2022 09:23:58 -0700 (PDT) Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 5.0.0) id b1d2a683a77102d0; Wed, 10 Aug 2022 18:23:56 +0200 Received: from kreacher.localnet (unknown [213.134.187.55]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by v370.home.net.pl (Postfix) with ESMTPSA id 24A4066CF1C; Wed, 10 Aug 2022 18:23:56 +0200 (CEST) From: "Rafael J. Wysocki" To: Linux ACPI Cc: LKML , Andy Shevchenko , Linux PM Subject: [PATCH v1 3/5] ACPI: scan: Rearrange initialization of ACPI device objects Date: Wed, 10 Aug 2022 18:16:33 +0200 Message-ID: <1828627.tdWV9SEqCh@kreacher> In-Reply-To: <12036348.O9o76ZdvQC@kreacher> References: <12036348.O9o76ZdvQC@kreacher> MIME-Version: 1.0 X-CLIENT-IP: 213.134.187.55 X-CLIENT-HOSTNAME: 213.134.187.55 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedvfedrvdegvddgleejucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecujffqoffgrffnpdggtffipffknecuuegrihhlohhuthemucduhedtnecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenucfjughrpefhvfevufffkfgjfhgggfgtsehtufertddttdejnecuhfhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqnecuggftrfgrthhtvghrnhepvdffueeitdfgvddtudegueejtdffteetgeefkeffvdeftddttdeuhfegfedvjefhnecukfhppedvudefrddufeegrddukeejrdehheenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpedvudefrddufeegrddukeejrdehhedphhgvlhhopehkrhgvrggthhgvrhdrlhhotggrlhhnvghtpdhmrghilhhfrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqedpnhgspghrtghpthhtohepgedprhgtphhtthhopehlihhnuhigqdgrtghpihesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopehlihhnuhigqdhkvghrnhgvlhesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopegrnhgurhhihidrshhhvghvtghhvghnkhhosehlihhnuhigrdhinhhtvghlrdgtohhmpdhrtghpthhtoheplhhinhhugidqphhmsehvghgvrhdrkhgvrhhn vghlrdhorhhg X-DCC--Metrics: v370.home.net.pl 1024; Body=4 Fuz1=4 Fuz2=4 Precedence: bulk List-ID: X-Mailing-List: linux-acpi@vger.kernel.org From: Rafael J. Wysocki The initialization of ACPI device objects is split between acpi_init_device_object() and __acpi_device_add() that initializes the dev field in struct acpi_device. The "release" function pointer is passed to __acpi_device_add() for this reason. However, that split is artificial and all of the initialization can be carried out by acpi_init_device_object(), so rearrange the code to that end. In particular, make acpi_init_device_object() take the "release" pointer as an argument, along with the "type" which is related to it, instead of __acpi_device_add(). No intentional functional impact. Signed-off-by: Rafael J. Wysocki --- drivers/acpi/internal.h | 5 ++--- drivers/acpi/power.c | 5 +++-- drivers/acpi/scan.c | 27 ++++++++++++++------------- 3 files changed, 19 insertions(+), 18 deletions(-) Index: linux-pm/drivers/acpi/scan.c =================================================================== --- linux-pm.orig/drivers/acpi/scan.c +++ linux-pm/drivers/acpi/scan.c @@ -673,8 +673,7 @@ static void acpi_store_pld_crc(struct ac ACPI_FREE(pld); } -static int __acpi_device_add(struct acpi_device *device, - void (*release)(struct device *)) +static int __acpi_device_add(struct acpi_device *device) { struct acpi_device_bus_id *acpi_device_bus_id; int result; @@ -730,11 +729,6 @@ static int __acpi_device_add(struct acpi mutex_unlock(&acpi_device_lock); - if (device->parent) - device->dev.parent = &device->parent->dev; - - device->dev.bus = &acpi_bus_type; - device->dev.release = release; result = device_add(&device->dev); if (result) { dev_err(&device->dev, "Error registering device\n"); @@ -761,7 +755,7 @@ err_unlock: return result; } -int acpi_device_add(struct acpi_device *adev, void (*release)(struct device *)) +int acpi_device_add(struct acpi_device *adev) { int ret; @@ -769,7 +763,7 @@ int acpi_device_add(struct acpi_device * if (ret) return ret; - return __acpi_device_add(adev, release); + return __acpi_device_add(adev); } /* -------------------------------------------------------------------------- @@ -1776,12 +1770,19 @@ static bool acpi_device_enumeration_by_p } void acpi_init_device_object(struct acpi_device *device, acpi_handle handle, - int type) + int type, void (*release)(struct device *)) { + struct acpi_device *parent = acpi_find_parent_acpi_dev(handle); + INIT_LIST_HEAD(&device->pnp.ids); device->device_type = type; device->handle = handle; - device->parent = acpi_find_parent_acpi_dev(handle); + if (parent) { + device->parent = parent; + device->dev.parent = &parent->dev; + } + device->dev.release = release; + device->dev.bus = &acpi_bus_type; fwnode_init(&device->fwnode, &acpi_device_fwnode_ops); acpi_set_device_status(device, ACPI_STA_DEFAULT); acpi_device_get_busid(device); @@ -1835,7 +1836,7 @@ static int acpi_add_single_object(struct if (!device) return -ENOMEM; - acpi_init_device_object(device, handle, type); + acpi_init_device_object(device, handle, type, acpi_device_release); /* * Getting the status is delayed till here so that we can call * acpi_bus_get_status() and use its quirk handling. Note that @@ -1865,7 +1866,7 @@ static int acpi_add_single_object(struct mutex_unlock(&acpi_dep_list_lock); if (!result) - result = __acpi_device_add(device, acpi_device_release); + result = __acpi_device_add(device); if (result) { acpi_device_release(&device->dev); Index: linux-pm/drivers/acpi/internal.h =================================================================== --- linux-pm.orig/drivers/acpi/internal.h +++ linux-pm/drivers/acpi/internal.h @@ -102,10 +102,9 @@ struct acpi_device_bus_id { struct list_head node; }; -int acpi_device_add(struct acpi_device *device, - void (*release)(struct device *)); void acpi_init_device_object(struct acpi_device *device, acpi_handle handle, - int type); + int type, void (*release)(struct device *)); +int acpi_device_add(struct acpi_device *device); int acpi_device_setup_files(struct acpi_device *dev); void acpi_device_remove_files(struct acpi_device *dev); void acpi_device_add_finalize(struct acpi_device *device); Index: linux-pm/drivers/acpi/power.c =================================================================== --- linux-pm.orig/drivers/acpi/power.c +++ linux-pm/drivers/acpi/power.c @@ -944,7 +944,8 @@ struct acpi_device *acpi_add_power_resou return NULL; device = &resource->device; - acpi_init_device_object(device, handle, ACPI_BUS_TYPE_POWER); + acpi_init_device_object(device, handle, ACPI_BUS_TYPE_POWER, + acpi_release_power_resource); mutex_init(&resource->resource_lock); INIT_LIST_HEAD(&resource->list_node); INIT_LIST_HEAD(&resource->dependents); @@ -968,7 +969,7 @@ struct acpi_device *acpi_add_power_resou pr_info("%s [%s]\n", acpi_device_name(device), acpi_device_bid(device)); device->flags.match_driver = true; - result = acpi_device_add(device, acpi_release_power_resource); + result = acpi_device_add(device); if (result) goto err; From patchwork Wed Aug 10 16:17:23 2022 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 7bit X-Patchwork-Submitter: "Rafael J. Wysocki" X-Patchwork-Id: 596447 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on aws-us-west-2-korg-lkml-1.web.codeaurora.org Received: from vger.kernel.org (vger.kernel.org [23.128.96.18]) by smtp.lore.kernel.org (Postfix) with ESMTP id 8599FC25B07 for ; Wed, 10 Aug 2022 16:24:23 +0000 (UTC) Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S230433AbiHJQYW (ORCPT ); Wed, 10 Aug 2022 12:24:22 -0400 Received: from lindbergh.monkeyblade.net ([23.128.96.19]:51958 "EHLO lindbergh.monkeyblade.net" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S232637AbiHJQX7 (ORCPT ); Wed, 10 Aug 2022 12:23:59 -0400 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) by lindbergh.monkeyblade.net (Postfix) with ESMTPS id F1EE8792E7; Wed, 10 Aug 2022 09:23:56 -0700 (PDT) Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 5.0.0) id 2d7ae212334240e6; Wed, 10 Aug 2022 18:23:55 +0200 Received: from kreacher.localnet (unknown [213.134.187.55]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by v370.home.net.pl (Postfix) with ESMTPSA id BD40B66CF1C; Wed, 10 Aug 2022 18:23:54 +0200 (CEST) From: "Rafael J. Wysocki" To: Linux ACPI Cc: LKML , Andy Shevchenko , Linux PM Subject: [PATCH v1 4/5] ACPI: scan: Eliminate __acpi_device_add() Date: Wed, 10 Aug 2022 18:17:23 +0200 Message-ID: <13078324.uLZWGnKmhe@kreacher> In-Reply-To: <12036348.O9o76ZdvQC@kreacher> References: <12036348.O9o76ZdvQC@kreacher> MIME-Version: 1.0 X-CLIENT-IP: 213.134.187.55 X-CLIENT-HOSTNAME: 213.134.187.55 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedvfedrvdegvddgleejucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecujffqoffgrffnpdggtffipffknecuuegrihhlohhuthemucduhedtnecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenucfjughrpefhvfevufffkfgjfhgggfgtsehtufertddttdejnecuhfhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqnecuggftrfgrthhtvghrnhepvdffueeitdfgvddtudegueejtdffteetgeefkeffvdeftddttdeuhfegfedvjefhnecukfhppedvudefrddufeegrddukeejrdehheenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpedvudefrddufeegrddukeejrdehhedphhgvlhhopehkrhgvrggthhgvrhdrlhhotggrlhhnvghtpdhmrghilhhfrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqedpnhgspghrtghpthhtohepgedprhgtphhtthhopehlihhnuhigqdgrtghpihesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopehlihhnuhigqdhkvghrnhgvlhesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopegrnhgurhhihidrshhhvghvtghhvghnkhhosehlihhnuhigrdhinhhtvghlrdgtohhmpdhrtghpthhtoheplhhinhhugidqphhmsehvghgvrhdrkhgvrhhn vghlrdhorhhg X-DCC--Metrics: v370.home.net.pl 1024; Body=4 Fuz1=4 Fuz2=4 Precedence: bulk List-ID: X-Mailing-List: linux-acpi@vger.kernel.org From: Rafael J. Wysocki Instead of having acpi_device_add() defined as a wrapper around __acpi_device_add(), export acpi_tie_acpi_dev() so it can be called directly by acpi_add_power_resource(), fold acpi_device_add() into the latter and rename __acpi_device_add() to acpi_device_add(). No intentional functional impact. Signed-off-by: Rafael J. Wysocki --- drivers/acpi/internal.h | 1 + drivers/acpi/power.c | 6 +++++- drivers/acpi/scan.c | 17 +++-------------- 3 files changed, 9 insertions(+), 15 deletions(-) Index: linux-pm/drivers/acpi/internal.h =================================================================== --- linux-pm.orig/drivers/acpi/internal.h +++ linux-pm/drivers/acpi/internal.h @@ -104,6 +104,7 @@ struct acpi_device_bus_id { void acpi_init_device_object(struct acpi_device *device, acpi_handle handle, int type, void (*release)(struct device *)); +int acpi_tie_acpi_dev(struct acpi_device *adev); int acpi_device_add(struct acpi_device *device); int acpi_device_setup_files(struct acpi_device *dev); void acpi_device_remove_files(struct acpi_device *dev); Index: linux-pm/drivers/acpi/scan.c =================================================================== --- linux-pm.orig/drivers/acpi/scan.c +++ linux-pm/drivers/acpi/scan.c @@ -643,7 +643,7 @@ static int acpi_device_set_name(struct a return 0; } -static int acpi_tie_acpi_dev(struct acpi_device *adev) +int acpi_tie_acpi_dev(struct acpi_device *adev) { acpi_handle handle = adev->handle; acpi_status status; @@ -673,7 +673,7 @@ static void acpi_store_pld_crc(struct ac ACPI_FREE(pld); } -static int __acpi_device_add(struct acpi_device *device) +int acpi_device_add(struct acpi_device *device) { struct acpi_device_bus_id *acpi_device_bus_id; int result; @@ -755,17 +755,6 @@ err_unlock: return result; } -int acpi_device_add(struct acpi_device *adev) -{ - int ret; - - ret = acpi_tie_acpi_dev(adev); - if (ret) - return ret; - - return __acpi_device_add(adev); -} - /* -------------------------------------------------------------------------- Device Enumeration -------------------------------------------------------------------------- */ @@ -1866,7 +1855,7 @@ static int acpi_add_single_object(struct mutex_unlock(&acpi_dep_list_lock); if (!result) - result = __acpi_device_add(device); + result = acpi_device_add(device); if (result) { acpi_device_release(&device->dev); Index: linux-pm/drivers/acpi/power.c =================================================================== --- linux-pm.orig/drivers/acpi/power.c +++ linux-pm/drivers/acpi/power.c @@ -952,6 +952,7 @@ struct acpi_device *acpi_add_power_resou strcpy(acpi_device_name(device), ACPI_POWER_DEVICE_NAME); strcpy(acpi_device_class(device), ACPI_POWER_CLASS); device->power.state = ACPI_STATE_UNKNOWN; + device->flags.match_driver = true; /* Evaluate the object to get the system level and resource order. */ status = acpi_evaluate_object(handle, NULL, NULL, &buffer); @@ -968,7 +969,10 @@ struct acpi_device *acpi_add_power_resou pr_info("%s [%s]\n", acpi_device_name(device), acpi_device_bid(device)); - device->flags.match_driver = true; + result = acpi_tie_acpi_dev(device); + if (result) + goto err; + result = acpi_device_add(device); if (result) goto err; From patchwork Wed Aug 10 16:23:05 2022 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 7bit X-Patchwork-Submitter: "Rafael J. Wysocki" X-Patchwork-Id: 596446 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on aws-us-west-2-korg-lkml-1.web.codeaurora.org Received: from vger.kernel.org (vger.kernel.org [23.128.96.18]) by smtp.lore.kernel.org (Postfix) with ESMTP id 4D1ABC00140 for ; Wed, 10 Aug 2022 16:24:54 +0000 (UTC) Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S232671AbiHJQYX (ORCPT ); Wed, 10 Aug 2022 12:24:23 -0400 Received: from lindbergh.monkeyblade.net ([23.128.96.19]:52000 "EHLO lindbergh.monkeyblade.net" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S232659AbiHJQYA (ORCPT ); Wed, 10 Aug 2022 12:24:00 -0400 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) by lindbergh.monkeyblade.net (Postfix) with ESMTPS id 85168760F8; Wed, 10 Aug 2022 09:23:56 -0700 (PDT) Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 5.0.0) id 91ea0ad7bd64d3e0; Wed, 10 Aug 2022 18:23:54 +0200 Received: from kreacher.localnet (unknown [213.134.187.55]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by v370.home.net.pl (Postfix) with ESMTPSA id A76F566CF1C; Wed, 10 Aug 2022 18:23:52 +0200 (CEST) From: "Rafael J. Wysocki" To: Linux ACPI Cc: LKML , Andy Shevchenko , Linux PM , "K. Y. Srinivasan" , Haiyang Zhang , Stephen Hemminger , Wei Liu , Dexuan Cui , Mark Brown , Andreas Noever , Michael Jamet , Mika Westerberg , Yehezkel Bernat , linux-hyperv@vger.kernel.org, linux-spi@vger.kernel.org, linux-usb@vger.kernel.org Subject: [PATCH v1 5/5][RFT] ACPI: Drop parent field from struct acpi_device Date: Wed, 10 Aug 2022 18:23:05 +0200 Message-ID: <2196460.iZASKD2KPV@kreacher> In-Reply-To: <12036348.O9o76ZdvQC@kreacher> References: <12036348.O9o76ZdvQC@kreacher> MIME-Version: 1.0 X-CLIENT-IP: 213.134.187.55 X-CLIENT-HOSTNAME: 213.134.187.55 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedvfedrvdegvddgleejucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecujffqoffgrffnpdggtffipffknecuuegrihhlohhuthemucduhedtnecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenucfjughrpefhvfevufffkfgjfhgggfgtsehtufertddttdejnecuhfhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqnecuggftrfgrthhtvghrnhepvdffueeitdfgvddtudegueejtdffteetgeefkeffvdeftddttdeuhfegfedvjefhnecukfhppedvudefrddufeegrddukeejrdehheenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpedvudefrddufeegrddukeejrdehhedphhgvlhhopehkrhgvrggthhgvrhdrlhhotggrlhhnvghtpdhmrghilhhfrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqedpnhgspghrtghpthhtohepudejpdhrtghpthhtoheplhhinhhugidqrggtphhisehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqkhgvrhhnvghlsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheprghnughrihihrdhshhgvvhgthhgvnhhkoheslhhinhhugidrihhnthgvlhdrtghomhdprhgtphhtthhopehlihhnuhigqdhpmhesvhhgvghrrdhkvghr nhgvlhdrohhrghdprhgtphhtthhopehkhihssehmihgtrhhoshhofhhtrdgtohhmpdhrtghpthhtohephhgrihihrghnghiisehmihgtrhhoshhofhhtrdgtohhmpdhrtghpthhtohepshhthhgvmhhmihhnsehmihgtrhhoshhofhhtrdgtohhmpdhrtghpthhtohepfigvihdrlhhiuheskhgvrhhnvghlrdhorhhgpdhrtghpthhtohepuggvtghuihesmhhitghrohhsohhfthdrtghomhdprhgtphhtthhopegsrhhoohhnihgvsehkvghrnhgvlhdrohhrghdprhgtphhtthhopegrnhgurhgvrghsrdhnohgvvhgvrhesghhmrghilhdrtghomhdprhgtphhtthhopehmihgthhgrvghlrdhjrghmvghtsehinhhtvghlrdgtohhmpdhrtghpthhtohepmhhikhgrrdifvghsthgvrhgsvghrgheslhhinhhugidrihhnthgvlhdrtghomhdprhgtphhtthhopegjvghhvgiikhgvlhfuhheusehgmhgrihhlrdgtohhmpdhrtghpthhtoheplhhinhhugidqhhihphgvrhhvsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqshhpihesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopehlihhnuhigqdhushgssehvghgvrhdrkhgvrhhnvghlrdhorhhg X-DCC--Metrics: v370.home.net.pl 1024; Body=17 Fuz1=17 Fuz2=17 Precedence: bulk List-ID: X-Mailing-List: linux-acpi@vger.kernel.org From: Rafael J. Wysocki The parent field in struct acpi_device is, in fact, redundant, because the dev.parent field in it effectively points to the same object and it is used by the driver core. Accordingly, the parent field can be dropped from struct acpi_device and for this purpose define acpi_dev_parent() to retrieve the parent struct acpi_device pointer from the dev.parent field in struct acpi_device. Next, update all of the users of the parent field in struct acpi_device to use acpi_dev_parent() instead of it and drop it. While at it, drop the ACPI_IS_ROOT_DEVICE() macro that is only used in one place in a confusing way. No intentional functional impact. Signed-off-by: Rafael J. Wysocki Acked-by: Mark Brown Acked-by: Wei Liu --- I may have missed some places where adev->parent is used directly, so if that's happened, please let me know (I'm assuming that 0-day will pick up this patch and run it through all of the relevant configs anyway). --- drivers/acpi/acpi_platform.c | 6 +++--- drivers/acpi/acpi_video.c | 2 +- drivers/acpi/device_pm.c | 19 ++++++++++--------- drivers/acpi/property.c | 6 ++++-- drivers/acpi/sbs.c | 2 +- drivers/acpi/sbshc.c | 2 +- drivers/acpi/scan.c | 17 ++++++----------- drivers/hv/vmbus_drv.c | 3 ++- drivers/spi/spi.c | 2 +- drivers/thunderbolt/acpi.c | 2 +- include/acpi/acpi_bus.h | 10 +++++++++- 11 files changed, 39 insertions(+), 32 deletions(-) Index: linux-pm/drivers/acpi/scan.c =================================================================== --- linux-pm.orig/drivers/acpi/scan.c +++ linux-pm/drivers/acpi/scan.c @@ -29,8 +29,6 @@ extern struct acpi_device *acpi_root; #define ACPI_BUS_HID "LNXSYBUS" #define ACPI_BUS_DEVICE_NAME "System Bus" -#define ACPI_IS_ROOT_DEVICE(device) (!(device)->parent) - #define INVALID_ACPI_HANDLE ((acpi_handle)empty_zero_page) static const char *dummy_hid = "device"; @@ -1110,7 +1108,7 @@ static void acpi_device_get_busid(struct * The device's Bus ID is simply the object name. * TBD: Shouldn't this value be unique (within the ACPI namespace)? */ - if (ACPI_IS_ROOT_DEVICE(device)) { + if (!acpi_dev_parent(device)) { strcpy(device->pnp.bus_id, "ACPI"); return; } @@ -1646,7 +1644,7 @@ static void acpi_init_coherency(struct a { unsigned long long cca = 0; acpi_status status; - struct acpi_device *parent = adev->parent; + struct acpi_device *parent = acpi_dev_parent(adev); if (parent && parent->flags.cca_seen) { /* @@ -1690,7 +1688,7 @@ static int acpi_check_serial_bus_slave(s static bool acpi_is_indirect_io_slave(struct acpi_device *device) { - struct acpi_device *parent = device->parent; + struct acpi_device *parent = acpi_dev_parent(device); static const struct acpi_device_id indirect_io_hosts[] = { {"HISI0191", 0}, {} @@ -1766,10 +1764,7 @@ void acpi_init_device_object(struct acpi INIT_LIST_HEAD(&device->pnp.ids); device->device_type = type; device->handle = handle; - if (parent) { - device->parent = parent; - device->dev.parent = &parent->dev; - } + device->dev.parent = parent ? &parent->dev : NULL; device->dev.release = release; device->dev.bus = &acpi_bus_type; fwnode_init(&device->fwnode, &acpi_device_fwnode_ops); @@ -1866,8 +1861,8 @@ static int acpi_add_single_object(struct acpi_device_add_finalize(device); acpi_handle_debug(handle, "Added as %s, parent %s\n", - dev_name(&device->dev), device->parent ? - dev_name(&device->parent->dev) : "(null)"); + dev_name(&device->dev), device->dev.parent ? + dev_name(device->dev.parent) : "(null)"); *child = device; return 0; Index: linux-pm/include/acpi/acpi_bus.h =================================================================== --- linux-pm.orig/include/acpi/acpi_bus.h +++ linux-pm/include/acpi/acpi_bus.h @@ -364,7 +364,6 @@ struct acpi_device { int device_type; acpi_handle handle; /* no handle for fixed hardware */ struct fwnode_handle fwnode; - struct acpi_device *parent; struct list_head wakeup_list; struct list_head del_list; struct acpi_device_status status; @@ -457,6 +456,14 @@ static inline void *acpi_driver_data(str #define to_acpi_device(d) container_of(d, struct acpi_device, dev) #define to_acpi_driver(d) container_of(d, struct acpi_driver, drv) +static inline struct acpi_device *acpi_dev_parent(struct acpi_device *adev) +{ + if (adev->dev.parent) + return to_acpi_device(adev->dev.parent); + + return NULL; +} + static inline void acpi_set_device_status(struct acpi_device *adev, u32 sta) { *((u32 *)&adev->status) = sta; @@ -477,6 +484,7 @@ void acpi_initialize_hp_context(struct a /* acpi_device.dev.bus == &acpi_bus_type */ extern struct bus_type acpi_bus_type; +struct acpi_device *acpi_dev_parent(struct acpi_device *adev); int acpi_bus_for_each_dev(int (*fn)(struct device *, void *), void *data); int acpi_dev_for_each_child(struct acpi_device *adev, int (*fn)(struct acpi_device *, void *), void *data); Index: linux-pm/drivers/acpi/property.c =================================================================== --- linux-pm.orig/drivers/acpi/property.c +++ linux-pm/drivers/acpi/property.c @@ -298,8 +298,10 @@ static void acpi_init_of_compatible(stru ret = acpi_dev_get_property(adev, "compatible", ACPI_TYPE_STRING, &of_compatible); if (ret) { - if (adev->parent - && adev->parent->flags.of_compatible_ok) + struct acpi_device *parent; + + parent = acpi_dev_parent(adev); + if (parent && parent->flags.of_compatible_ok) goto out; return; Index: linux-pm/drivers/acpi/device_pm.c =================================================================== --- linux-pm.orig/drivers/acpi/device_pm.c +++ linux-pm/drivers/acpi/device_pm.c @@ -74,6 +74,7 @@ static int acpi_dev_pm_explicit_get(stru */ int acpi_device_get_power(struct acpi_device *device, int *state) { + struct acpi_device *parent = acpi_dev_parent(device); int result = ACPI_STATE_UNKNOWN; int error; @@ -82,8 +83,7 @@ int acpi_device_get_power(struct acpi_de if (!device->flags.power_manageable) { /* TBD: Non-recursive algorithm for walking up hierarchy. */ - *state = device->parent ? - device->parent->power.state : ACPI_STATE_D0; + *state = parent ? parent->power.state : ACPI_STATE_D0; goto out; } @@ -122,10 +122,10 @@ int acpi_device_get_power(struct acpi_de * point, the fact that the device is in D0 implies that the parent has * to be in D0 too, except if ignore_parent is set. */ - if (!device->power.flags.ignore_parent && device->parent - && device->parent->power.state == ACPI_STATE_UNKNOWN - && result == ACPI_STATE_D0) - device->parent->power.state = ACPI_STATE_D0; + if (!device->power.flags.ignore_parent && parent && + parent->power.state == ACPI_STATE_UNKNOWN && + result == ACPI_STATE_D0) + parent->power.state = ACPI_STATE_D0; *state = result; @@ -159,6 +159,7 @@ static int acpi_dev_pm_explicit_set(stru */ int acpi_device_set_power(struct acpi_device *device, int state) { + struct acpi_device *parent = acpi_dev_parent(device); int target_state = state; int result = 0; @@ -191,12 +192,12 @@ int acpi_device_set_power(struct acpi_de return -ENODEV; } - if (!device->power.flags.ignore_parent && device->parent && - state < device->parent->power.state) { + if (!device->power.flags.ignore_parent && parent && + state < parent->power.state) { acpi_handle_debug(device->handle, "Cannot transition to %s for parent in %s\n", acpi_power_state_string(state), - acpi_power_state_string(device->parent->power.state)); + acpi_power_state_string(parent->power.state)); return -ENODEV; } Index: linux-pm/drivers/acpi/acpi_platform.c =================================================================== --- linux-pm.orig/drivers/acpi/acpi_platform.c +++ linux-pm/drivers/acpi/acpi_platform.c @@ -78,7 +78,7 @@ static void acpi_platform_fill_resource( * If the device has parent we need to take its resources into * account as well because this device might consume part of those. */ - parent = acpi_get_first_physical_node(adev->parent); + parent = acpi_get_first_physical_node(acpi_dev_parent(adev)); if (parent && dev_is_pci(parent)) dest->parent = pci_find_resource(to_pci_dev(parent), dest); } @@ -97,6 +97,7 @@ static void acpi_platform_fill_resource( struct platform_device *acpi_create_platform_device(struct acpi_device *adev, const struct property_entry *properties) { + struct acpi_device *parent = acpi_dev_parent(adev); struct platform_device *pdev = NULL; struct platform_device_info pdevinfo; struct resource_entry *rentry; @@ -137,8 +138,7 @@ struct platform_device *acpi_create_plat * attached to it, that physical device should be the parent of the * platform device we are about to create. */ - pdevinfo.parent = adev->parent ? - acpi_get_first_physical_node(adev->parent) : NULL; + pdevinfo.parent = parent ? acpi_get_first_physical_node(parent) : NULL; pdevinfo.name = dev_name(&adev->dev); pdevinfo.id = -1; pdevinfo.res = resources; Index: linux-pm/drivers/acpi/acpi_video.c =================================================================== --- linux-pm.orig/drivers/acpi/acpi_video.c +++ linux-pm/drivers/acpi/acpi_video.c @@ -2030,7 +2030,7 @@ static int acpi_video_bus_add(struct acp acpi_status status; status = acpi_walk_namespace(ACPI_TYPE_DEVICE, - device->parent->handle, 1, + acpi_dev_parent(device)->handle, 1, acpi_video_bus_match, NULL, device, NULL); if (status == AE_ALREADY_EXISTS) { Index: linux-pm/drivers/acpi/sbs.c =================================================================== --- linux-pm.orig/drivers/acpi/sbs.c +++ linux-pm/drivers/acpi/sbs.c @@ -632,7 +632,7 @@ static int acpi_sbs_add(struct acpi_devi mutex_init(&sbs->lock); - sbs->hc = acpi_driver_data(device->parent); + sbs->hc = acpi_driver_data(acpi_dev_parent(device)); sbs->device = device; strcpy(acpi_device_name(device), ACPI_SBS_DEVICE_NAME); strcpy(acpi_device_class(device), ACPI_SBS_CLASS); Index: linux-pm/drivers/acpi/sbshc.c =================================================================== --- linux-pm.orig/drivers/acpi/sbshc.c +++ linux-pm/drivers/acpi/sbshc.c @@ -266,7 +266,7 @@ static int acpi_smbus_hc_add(struct acpi mutex_init(&hc->lock); init_waitqueue_head(&hc->wait); - hc->ec = acpi_driver_data(device->parent); + hc->ec = acpi_driver_data(acpi_dev_parent(device)); hc->offset = (val >> 8) & 0xff; hc->query_bit = val & 0xff; device->driver_data = hc; Index: linux-pm/drivers/spi/spi.c =================================================================== --- linux-pm.orig/drivers/spi/spi.c +++ linux-pm/drivers/spi/spi.c @@ -4256,7 +4256,7 @@ static int acpi_spi_notify(struct notifi switch (value) { case ACPI_RECONFIG_DEVICE_ADD: - ctlr = acpi_spi_find_controller_by_adev(adev->parent); + ctlr = acpi_spi_find_controller_by_adev(acpi_dev_parent(adev)); if (!ctlr) break; Index: linux-pm/drivers/thunderbolt/acpi.c =================================================================== --- linux-pm.orig/drivers/thunderbolt/acpi.c +++ linux-pm/drivers/thunderbolt/acpi.c @@ -42,7 +42,7 @@ static acpi_status tb_acpi_add_link(acpi */ dev = acpi_get_first_physical_node(adev); while (!dev) { - adev = adev->parent; + adev = acpi_dev_parent(adev); if (!adev) break; dev = acpi_get_first_physical_node(adev); Index: linux-pm/drivers/hv/vmbus_drv.c =================================================================== --- linux-pm.orig/drivers/hv/vmbus_drv.c +++ linux-pm/drivers/hv/vmbus_drv.c @@ -2423,7 +2423,8 @@ static int vmbus_acpi_add(struct acpi_de * Some ancestor of the vmbus acpi device (Gen1 or Gen2 * firmware) is the VMOD that has the mmio ranges. Get that. */ - for (ancestor = device->parent; ancestor; ancestor = ancestor->parent) { + for (ancestor = acpi_dev_parent(device); ancestor; + ancestor = acpi_dev_parent(ancestor)) { result = acpi_walk_resources(ancestor->handle, METHOD_NAME__CRS, vmbus_walk_resources, NULL);