From patchwork Fri Aug 25 16:16:51 2023 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 7bit X-Patchwork-Submitter: "Rafael J. Wysocki" X-Patchwork-Id: 717430 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on aws-us-west-2-korg-lkml-1.web.codeaurora.org Received: from vger.kernel.org (vger.kernel.org [23.128.96.18]) by smtp.lore.kernel.org (Postfix) with ESMTP id 19B96EE49A5 for ; Fri, 25 Aug 2023 16:17:30 +0000 (UTC) Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S243202AbjHYQQ5 (ORCPT ); Fri, 25 Aug 2023 12:16:57 -0400 Received: from lindbergh.monkeyblade.net ([23.128.96.19]:45848 "EHLO lindbergh.monkeyblade.net" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S245225AbjHYQQ4 (ORCPT ); Fri, 25 Aug 2023 12:16:56 -0400 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) by lindbergh.monkeyblade.net (Postfix) with ESMTPS id 44DDC1BD2; Fri, 25 Aug 2023 09:16:54 -0700 (PDT) Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 5.2.0) id 8ad44d5f7b6bf935; Fri, 25 Aug 2023 18:16:52 +0200 Authentication-Results: v370.home.net.pl; spf=softfail (domain owner discourages use of this host) smtp.mailfrom=rjwysocki.net (client-ip=195.136.19.94; helo=[195.136.19.94]; envelope-from=rjw@rjwysocki.net; receiver=) Received: from kreacher.localnet (unknown [195.136.19.94]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by v370.home.net.pl (Postfix) with ESMTPSA id AED3D662F61; Fri, 25 Aug 2023 18:16:51 +0200 (CEST) From: "Rafael J. Wysocki" To: Linux PM Cc: Linux ACPI , LKML , Daniel Lezcano , Zhang Rui , Srinivas Pandruvada , Amit Kucheria Subject: [PATCH v1] thermal: core: Drop unused .get_trip_*() callbacks Date: Fri, 25 Aug 2023 18:16:51 +0200 Message-ID: <12270283.O9o76ZdvQC@kreacher> MIME-Version: 1.0 X-CLIENT-IP: 195.136.19.94 X-CLIENT-HOSTNAME: 195.136.19.94 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedviedruddvkedgleejucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecujffqoffgrffnpdggtffipffknecuuegrihhlohhuthemucduhedtnecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenucfjughrpefhvfevufffkfgggfgtsehtufertddttdejnecuhfhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqnecuggftrfgrthhtvghrnhepffffffekgfehheffleetieevfeefvefhleetjedvvdeijeejledvieehueevueffnecukfhppeduleehrddufeeirdduledrleegnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepudelhedrudefiedrudelrdelgedphhgvlhhopehkrhgvrggthhgvrhdrlhhotggrlhhnvghtpdhmrghilhhfrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqedpnhgspghrtghpthhtohepjedprhgtphhtthhopehlihhnuhigqdhpmhesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopehlihhnuhigqdgrtghpihesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopehlihhnuhigqdhkvghrnhgvlhesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopegurghnihgvlhdrlhgviigtrghnoheslhhinhgrrhhordhorhhgpdhrtghpthht oheprhhuihdriihhrghnghesihhnthgvlhdrtghomhdprhgtphhtthhopehsrhhinhhivhgrshdrphgrnhgurhhuvhgruggrsehlihhnuhigrdhinhhtvghlrdgtohhm X-DCC--Metrics: v370.home.net.pl 1024; Body=7 Fuz1=7 Fuz2=7 Precedence: bulk List-ID: X-Mailing-List: linux-acpi@vger.kernel.org From: Rafael J. Wysocki After recent changes in the ACPI thermal driver and in the Intel DTS IOSF thermal driver, all thermal zone drivers are expected to use trip tables for initialization and none of them should implement .get_trip_type(), .get_trip_temp() or .get_trip_hyst() callbacks, so drop these callbacks entirely from the core. Signed-off-by: Rafael J. Wysocki --- drivers/thermal/thermal_core.c | 2 +- drivers/thermal/thermal_trip.c | 22 +++------------------- include/linux/thermal.h | 4 ---- 3 files changed, 4 insertions(+), 24 deletions(-) Index: linux-pm/include/linux/thermal.h =================================================================== --- linux-pm.orig/include/linux/thermal.h +++ linux-pm/include/linux/thermal.h @@ -76,11 +76,7 @@ struct thermal_zone_device_ops { int (*set_trips) (struct thermal_zone_device *, int, int); int (*change_mode) (struct thermal_zone_device *, enum thermal_device_mode); - int (*get_trip_type) (struct thermal_zone_device *, int, - enum thermal_trip_type *); - int (*get_trip_temp) (struct thermal_zone_device *, int, int *); int (*set_trip_temp) (struct thermal_zone_device *, int, int); - int (*get_trip_hyst) (struct thermal_zone_device *, int, int *); int (*set_trip_hyst) (struct thermal_zone_device *, int, int); int (*get_crit_temp) (struct thermal_zone_device *, int *); int (*set_emul_temp) (struct thermal_zone_device *, int); Index: linux-pm/drivers/thermal/thermal_trip.c =================================================================== --- linux-pm.orig/drivers/thermal/thermal_trip.c +++ linux-pm/drivers/thermal/thermal_trip.c @@ -118,27 +118,11 @@ int __thermal_zone_get_trip(struct therm { int ret; - if (!tz || trip_id < 0 || trip_id >= tz->num_trips || !trip) + if (!tz || !tz->trips || trip_id < 0 || trip_id >= tz->num_trips || !trip) return -EINVAL; - if (tz->trips) { - *trip = tz->trips[trip_id]; - return 0; - } - - if (tz->ops->get_trip_hyst) { - ret = tz->ops->get_trip_hyst(tz, trip_id, &trip->hysteresis); - if (ret) - return ret; - } else { - trip->hysteresis = 0; - } - - ret = tz->ops->get_trip_temp(tz, trip_id, &trip->temperature); - if (ret) - return ret; - - return tz->ops->get_trip_type(tz, trip_id, &trip->type); + *trip = tz->trips[trip_id]; + return 0; } EXPORT_SYMBOL_GPL(__thermal_zone_get_trip); Index: linux-pm/drivers/thermal/thermal_core.c =================================================================== --- linux-pm.orig/drivers/thermal/thermal_core.c +++ linux-pm/drivers/thermal/thermal_core.c @@ -1266,7 +1266,7 @@ thermal_zone_device_register_with_trips( return ERR_PTR(-EINVAL); } - if (num_trips > 0 && (!ops->get_trip_type || !ops->get_trip_temp) && !trips) + if (num_trips > 0 && !trips) return ERR_PTR(-EINVAL); if (!thermal_class)