From patchwork Fri May 30 10:00:09 2025 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 7bit X-Patchwork-Submitter: Mathieu Dubois-Briand X-Patchwork-Id: 893770 Received: from relay7-d.mail.gandi.net (relay7-d.mail.gandi.net [217.70.183.200]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by smtp.subspace.kernel.org (Postfix) with ESMTPS id D483F13A244; Fri, 30 May 2025 10:00:37 +0000 (UTC) Authentication-Results: smtp.subspace.kernel.org; arc=none smtp.client-ip=217.70.183.200 ARC-Seal: i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1748599240; cv=none; b=njtzC1+pYcrsBC4AOaoanm4p1HRdiwomWHRlMwCSvMqDtadqq3ABse3OPV39dkAInZMtXqEni2oufK2duEeb9HdsWjSc8QK2DuegB02YFEjDi/VvDsk8vGY2NxIkWn2nGPovxSo1nTLMAtAzylV5++zMDna6udMhk1iXtBTEE8E= ARC-Message-Signature: i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1748599240; c=relaxed/simple; bh=dk/vOyekPaxUPGQVlP91l7WD880+k0K+cVWxAiOYEDA=; h=From:Date:Subject:MIME-Version:Content-Type:Message-Id:References: In-Reply-To:To:Cc; b=OlqYg/YdCGz/z3T7qTgP/aZHgJjB14iVHbqramKDeTiatbuGwS9EJQLAbksr1Y0WbjxdPGFwJVtMCQHPo2G6IgTJsP1IzKl+SoO3SyHZ8k+0sONUMrFsDX3uh8RTvh+AlXavHhJoNVSJ9PKfn/n6NYuO8KR+hsK/i1nar7zFCQY= ARC-Authentication-Results: i=1; smtp.subspace.kernel.org; dmarc=pass (p=reject dis=none) header.from=bootlin.com; spf=pass smtp.mailfrom=bootlin.com; dkim=pass (2048-bit key) header.d=bootlin.com header.i=@bootlin.com header.b=Hngi1jwg; arc=none smtp.client-ip=217.70.183.200 Authentication-Results: smtp.subspace.kernel.org; dmarc=pass (p=reject dis=none) header.from=bootlin.com Authentication-Results: smtp.subspace.kernel.org; spf=pass smtp.mailfrom=bootlin.com Authentication-Results: smtp.subspace.kernel.org; dkim=pass (2048-bit key) header.d=bootlin.com header.i=@bootlin.com header.b="Hngi1jwg" Received: by mail.gandi.net (Postfix) with ESMTPSA id 1F5BF438F0; Fri, 30 May 2025 10:00:35 +0000 (UTC) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=bootlin.com; s=gm1; t=1748599236; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:cc:mime-version:mime-version:content-type:content-type: content-transfer-encoding:content-transfer-encoding: in-reply-to:in-reply-to:references:references; bh=QEoiRvlYtbFSAa8oj8odOk/YLCxewSlJ4hvGsB2qEJ8=; b=Hngi1jwgBQK0ML93xWlCGVPcP/n+Kx1oSPHZhyobUTWDGePdQpdSIrr3GBmFfaCoNRgaJe GHa9FrxiziptisAdS3El1qODNp0tvvre+39jW+sfPLzh5IM3+996sztM6z/d7nqD8vrzGR bYdnJ0H7eAazbau74CWIK9/c44JcNTqAA7/oKWFk4LrDRp+Gh9TLvR1MJ8nIHDXsEb0DFt IkPhOoqfW6I+qTIDn3yGlhozYtIvefO1ICxOLmcU/M3gsxacdJr36f4t5eT6Q/8LUrnTV+ RTVHxyHGPFObrWae43jB+2E1FIosAzOHTIPSZ3J8f0n9LrfaMnSFKz2sIxpoNQ== From: Mathieu Dubois-Briand Date: Fri, 30 May 2025 12:00:09 +0200 Subject: [PATCH v10 01/11] dt-bindings: mfd: gpio: Add MAX7360 Precedence: bulk X-Mailing-List: linux-gpio@vger.kernel.org List-Id: List-Subscribe: List-Unsubscribe: MIME-Version: 1.0 Message-Id: <20250530-mdb-max7360-support-v10-1-ce3b9e60a588@bootlin.com> References: <20250530-mdb-max7360-support-v10-0-ce3b9e60a588@bootlin.com> In-Reply-To: <20250530-mdb-max7360-support-v10-0-ce3b9e60a588@bootlin.com> To: Lee Jones , Rob Herring , Krzysztof Kozlowski , Conor Dooley , Kamel Bouhara , Linus Walleij , Bartosz Golaszewski , Dmitry Torokhov , =?utf-8?q?Uwe_Kleine-K=C3=B6n?= =?utf-8?q?ig?= , Michael Walle , Mark Brown , Greg Kroah-Hartman , "Rafael J. Wysocki" , Danilo Krummrich Cc: devicetree@vger.kernel.org, linux-kernel@vger.kernel.org, linux-gpio@vger.kernel.org, linux-input@vger.kernel.org, linux-pwm@vger.kernel.org, andriy.shevchenko@intel.com, =?utf-8?q?Gr=C3=A9?= =?utf-8?q?gory_Clement?= , Thomas Petazzoni , Mathieu Dubois-Briand X-Mailer: b4 0.14.1 X-Developer-Signature: v=1; a=ed25519-sha256; t=1748599233; l=8394; i=mathieu.dubois-briand@bootlin.com; s=20241219; h=from:subject:message-id; bh=dk/vOyekPaxUPGQVlP91l7WD880+k0K+cVWxAiOYEDA=; b=7O1KzpF5MBwD+2BdodIrUTCSBM9qOat8EsGhZSWhLjrd5E5EOqcvsfBNbmvlOqKEn9SRld63s 7Ee6X5UVP9dCVvcpgNjLXkvMvH1+BjGvSV4PiT2JYHERQoR9Knrlbvg X-Developer-Key: i=mathieu.dubois-briand@bootlin.com; a=ed25519; pk=1PVTmzPXfKvDwcPUzG0aqdGoKZJA3b9s+3DqRlm0Lww= X-GND-State: clean X-GND-Score: -100 X-GND-Cause: gggruggvucftvghtrhhoucdtuddrgeeffedrtddtgddvkeejvdculddtuddrgeefvddrtddtmdcutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfitefpfffkpdcuggftfghnshhusghstghrihgsvgenuceurghilhhouhhtmecufedtudenucesvcftvggtihhpihgvnhhtshculddquddttddmnecujfgurhephfffufggtgfgkfhfjgfvvefosehtjeertdertdejnecuhfhrohhmpeforghthhhivghuucffuhgsohhishdquehrihgrnhguuceomhgrthhhihgvuhdrughusghoihhsqdgsrhhirghnugessghoohhtlhhinhdrtghomheqnecuggftrfgrthhtvghrnhepheejtdfffeegfeelleektedvgefgteegtdejtedutdevteegtdeileefgfdviefhnecuffhomhgrihhnpeguvghvihgtvghtrhgvvgdrohhrghdprghnrghlohhgrdgtohhmnecukfhppedvrgdtudemtggsudegmeehheeimeejrgdttdemfehftghfmehfsgdtugemuddviedvmedvvgejieenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpedvrgdtudemtggsudegmeehheeimeejrgdttdemfehftghfmehfsgdtugemuddviedvmedvvgejiedphhgvlhhopegluddvjedrtddruddrudgnpdhmrghilhhfrhhomhepmhgrthhhihgvuhdrughusghoihhsqdgsrhhirghnugessghoohhtlhhinhdrtghomhdpnhgspghrtghpthhtohepvdefpdhrtghpthhtohepughmihhtrhihrdhtohhrohhkhhhovhesghhmrghil hdrtghomhdprhgtphhtthhopehlihhnuhigqdhkvghrnhgvlhesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopehrrghfrggvlheskhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqihhnphhuthesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopehlihhnuhigqdhpfihmsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtohepghhrvghgohhrhidrtghlvghmvghnthessghoohhtlhhinhdrtghomhdprhgtphhtthhopehmfigrlhhlvgeskhgvrhhnvghlrdhorhhgpdhrtghpthhtohepuggvvhhitggvthhrvggvsehvghgvrhdrkhgvrhhnvghlrdhorhhg X-GND-Sasl: mathieu.dubois-briand@bootlin.com Add device tree bindings for Maxim Integrated MAX7360 device with support for keypad, rotary, gpios and pwm functionalities. Reviewed-by: Rob Herring (Arm) Signed-off-by: Mathieu Dubois-Briand --- .../bindings/gpio/maxim,max7360-gpio.yaml | 83 +++++++++ .../devicetree/bindings/mfd/maxim,max7360.yaml | 191 +++++++++++++++++++++ 2 files changed, 274 insertions(+) diff --git a/Documentation/devicetree/bindings/gpio/maxim,max7360-gpio.yaml b/Documentation/devicetree/bindings/gpio/maxim,max7360-gpio.yaml new file mode 100644 index 000000000000..c5c3fc4c816f --- /dev/null +++ b/Documentation/devicetree/bindings/gpio/maxim,max7360-gpio.yaml @@ -0,0 +1,83 @@ +# SPDX-License-Identifier: (GPL-2.0-only OR BSD-2-Clause) +%YAML 1.2 +--- +$id: http://devicetree.org/schemas/gpio/maxim,max7360-gpio.yaml# +$schema: http://devicetree.org/meta-schemas/core.yaml# + +title: Maxim MAX7360 GPIO controller + +maintainers: + - Kamel Bouhara + - Mathieu Dubois-Briand + +description: | + Maxim MAX7360 GPIO controller, in MAX7360 chipset + https://www.analog.com/en/products/max7360.html + + The device provides two series of GPIOs, referred here as GPIOs and GPOs. + + PORT0 to PORT7 pins can be used as GPIOs, with support for interrupts and + constant-current mode. These pins will also be used by the rotary encoder and + PWM functionalities. + + COL2 to COL7 pins can be used as GPOs, there is no input capability. COL pins + will be partitioned, with the first pins being affected to the keypad + functionality and the last ones as GPOs. + +properties: + compatible: + enum: + - maxim,max7360-gpio + - maxim,max7360-gpo + + gpio-controller: true + + "#gpio-cells": + const: 2 + + interrupt-controller: true + + "#interrupt-cells": + const: 2 + + maxim,constant-current-disable: + $ref: /schemas/types.yaml#/definitions/uint32 + description: + Bit field, each bit disables constant-current output of the associated + GPIO, starting from the least significant bit for the first GPIO. + maximum: 0xff + +required: + - compatible + - gpio-controller + +allOf: + - if: + properties: + compatible: + contains: + enum: + - maxim,max7360-gpio + ngpios: false + then: + required: + - interrupt-controller + else: + properties: + interrupt-controller: false + maxim,constant-current-disable: false + +additionalProperties: false + +examples: + - | + gpio { + compatible = "maxim,max7360-gpio"; + + gpio-controller; + #gpio-cells = <2>; + maxim,constant-current-disable = <0x06>; + + interrupt-controller; + #interrupt-cells = <2>; + }; diff --git a/Documentation/devicetree/bindings/mfd/maxim,max7360.yaml b/Documentation/devicetree/bindings/mfd/maxim,max7360.yaml new file mode 100644 index 000000000000..3fc920c8639d --- /dev/null +++ b/Documentation/devicetree/bindings/mfd/maxim,max7360.yaml @@ -0,0 +1,191 @@ +# SPDX-License-Identifier: (GPL-2.0-only OR BSD-2-Clause) +%YAML 1.2 +--- +$id: http://devicetree.org/schemas/mfd/maxim,max7360.yaml# +$schema: http://devicetree.org/meta-schemas/core.yaml# + +title: Maxim MAX7360 Keypad, Rotary encoder, PWM and GPIO controller + +maintainers: + - Kamel Bouhara + - Mathieu Dubois-Briand + +description: | + Maxim MAX7360 device, with following functions: + - keypad controller + - rotary controller + - GPIO and GPO controller + - PWM controller + + https://www.analog.com/en/products/max7360.html + +allOf: + - $ref: /schemas/input/matrix-keymap.yaml# + - $ref: /schemas/input/input.yaml# + +properties: + compatible: + enum: + - maxim,max7360 + + reg: + maxItems: 1 + + interrupts: + maxItems: 2 + + interrupt-names: + items: + - const: inti + - const: intk + + keypad-debounce-delay-ms: + description: Keypad debounce delay in ms + minimum: 9 + maximum: 40 + default: 9 + + rotary-debounce-delay-ms: + description: Rotary encoder debounce delay in ms + minimum: 0 + maximum: 15 + default: 0 + + linux,axis: + $ref: /schemas/input/rotary-encoder.yaml#/properties/linux,axis + + rotary-encoder,relative-axis: + $ref: /schemas/types.yaml#/definitions/flag + description: + Register a relative axis rather than an absolute one. + + rotary-encoder,steps: + $ref: /schemas/types.yaml#/definitions/uint32 + default: 24 + description: + Number of steps in a full turnaround of the + encoder. Only relevant for absolute axis. Defaults to 24 which is a + typical value for such devices. + + rotary-encoder,rollover: + $ref: /schemas/types.yaml#/definitions/flag + description: + Automatic rollover when the rotary value becomes + greater than the specified steps or smaller than 0. For absolute axis only. + + "#pwm-cells": + const: 3 + + gpio: + $ref: /schemas/gpio/maxim,max7360-gpio.yaml# + description: + PORT0 to PORT7 general purpose input/output pins configuration. + + gpo: + $ref: /schemas/gpio/maxim,max7360-gpio.yaml# + description: > + COL2 to COL7 general purpose output pins configuration. Allows to use + unused keypad columns as outputs. + + The MAX7360 has 8 column lines and 6 of them can be used as GPOs. GPIOs + numbers used for this gpio-controller node do correspond to the column + numbers: values 0 and 1 are never valid, values from 2 to 7 might be valid + depending on the value of the keypad,num-column property. + +patternProperties: + '-pins$': + type: object + description: + Pinctrl node's client devices use subnodes for desired pin configuration. + Client device subnodes use below standard properties. + $ref: /schemas/pinctrl/pincfg-node.yaml + + properties: + pins: + description: + List of gpio pins affected by the properties specified in this + subnode. + items: + pattern: '^(PORT[0-7]|ROTARY)$' + minItems: 1 + maxItems: 8 + + function: + description: + Specify the alternative function to be configured for the specified + pins. + enum: [gpio, pwm, rotary] + + additionalProperties: false + +required: + - compatible + - reg + - interrupts + - interrupt-names + - linux,keymap + - linux,axis + - "#pwm-cells" + - gpio + - gpo + +unevaluatedProperties: false + +examples: + - | + #include + #include + + i2c { + #address-cells = <1>; + #size-cells = <0>; + + io-expander@38 { + compatible = "maxim,max7360"; + reg = <0x38>; + + interrupt-parent = <&gpio1>; + interrupts = <23 IRQ_TYPE_LEVEL_LOW>, + <24 IRQ_TYPE_LEVEL_LOW>; + interrupt-names = "inti", "intk"; + + keypad,num-rows = <8>; + keypad,num-columns = <4>; + linux,keymap = < + MATRIX_KEY(0x00, 0x00, KEY_F5) + MATRIX_KEY(0x01, 0x00, KEY_F4) + MATRIX_KEY(0x02, 0x01, KEY_F6) + >; + keypad-debounce-delay-ms = <10>; + autorepeat; + + rotary-debounce-delay-ms = <2>; + linux,axis = <0>; /* REL_X */ + rotary-encoder,relative-axis; + + #pwm-cells = <3>; + + max7360_gpio: gpio { + compatible = "maxim,max7360-gpio"; + + gpio-controller; + #gpio-cells = <2>; + maxim,constant-current-disable = <0x06>; + + interrupt-controller; + #interrupt-cells = <0x2>; + }; + + max7360_gpo: gpo { + compatible = "maxim,max7360-gpo"; + + gpio-controller; + #gpio-cells = <2>; + }; + + backlight_pins: backlight-pins { + pins = "PORT2"; + function = "pwm"; + }; + }; + }; From patchwork Fri May 30 10:00:11 2025 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 7bit X-Patchwork-Submitter: Mathieu Dubois-Briand X-Patchwork-Id: 893769 Received: from relay7-d.mail.gandi.net (relay7-d.mail.gandi.net [217.70.183.200]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by smtp.subspace.kernel.org (Postfix) with ESMTPS id F201921D3E9; Fri, 30 May 2025 10:00:39 +0000 (UTC) Authentication-Results: smtp.subspace.kernel.org; arc=none smtp.client-ip=217.70.183.200 ARC-Seal: i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1748599242; cv=none; b=sI24ncxy9tv25jaK0gI2X+5IXcPdAq7hjJp7wEcrQhPrTb/Kw9421RotXlswru3GultRdEQA77fJNTRfsq219208zNKn9fYNgVnIk3mQK/fJwXys06wdt44IHYvwGBnb8g4EdW+zSX4xZegQxANqf2vrLY8xm+maI2LZiREguF0= ARC-Message-Signature: i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1748599242; c=relaxed/simple; bh=hGsZR55OfihDnF2tEvh7g9JNQPSI7GKyZaRHC0o8rL8=; h=From:Date:Subject:MIME-Version:Content-Type:Message-Id:References: In-Reply-To:To:Cc; b=MPKyUAq2q0WPj+Yqyq+DVq7JjG0yB0Lg9teplq9/WVQUijXXUkzOBLiC2KGi0x0EEbbFN2FJu+LvBa/Xr0t4cMVQ6GSt16cotIQ7BLpVS/sJsacScs3wt3ph+fgRCIhHhewx1A4Kr33ipGsUXC8k08aLImfld6k2ydHSRxTuXp8= ARC-Authentication-Results: i=1; smtp.subspace.kernel.org; dmarc=pass (p=reject dis=none) header.from=bootlin.com; spf=pass smtp.mailfrom=bootlin.com; dkim=pass (2048-bit key) header.d=bootlin.com header.i=@bootlin.com header.b=kUe2Evby; arc=none smtp.client-ip=217.70.183.200 Authentication-Results: smtp.subspace.kernel.org; dmarc=pass (p=reject dis=none) header.from=bootlin.com Authentication-Results: smtp.subspace.kernel.org; spf=pass smtp.mailfrom=bootlin.com Authentication-Results: smtp.subspace.kernel.org; dkim=pass (2048-bit key) header.d=bootlin.com header.i=@bootlin.com header.b="kUe2Evby" Received: by mail.gandi.net (Postfix) with ESMTPSA id 1B59C43968; Fri, 30 May 2025 10:00:37 +0000 (UTC) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=bootlin.com; s=gm1; t=1748599238; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:cc:mime-version:mime-version:content-type:content-type: content-transfer-encoding:content-transfer-encoding: in-reply-to:in-reply-to:references:references; bh=viK3vhxx5RipA5TXaiZo7ax6KLs4M4zWzP2KGresXnI=; b=kUe2EvbyNjYdr5uEzmao+aW8AvUZRoeEzxM5aDZUpbFiiwiUPXTACP03w83vwgKotlbKo/ hgW6jJ9Fh03cAces/6hUqTvDancqKoW9fwGBMeFOrzB1mqcVlL+0gfarMp56mwplgxPyDQ VGlAiRY819Djg1fr7TdOnQ3vfEOcmTjLmDy8jyznm0e4jSNvU8LfmbfO7h/JEMDg2ZcBCR qmb6LT8hERp2ppJpvrOQoQnifjNZqBshVEtPLnORAjg/oiQ8x/rTHe2+VQPDOJeRIozEjA 9F8qso+tOJkWPExJXLWkdTM+35gHlsK13lErMO+tmvHlHJE/a8XeK9CTX32ZSA== From: Mathieu Dubois-Briand Date: Fri, 30 May 2025 12:00:11 +0200 Subject: [PATCH v10 03/11] pinctrl: Add MAX7360 pinctrl driver Precedence: bulk X-Mailing-List: linux-gpio@vger.kernel.org List-Id: List-Subscribe: List-Unsubscribe: MIME-Version: 1.0 Message-Id: <20250530-mdb-max7360-support-v10-3-ce3b9e60a588@bootlin.com> References: <20250530-mdb-max7360-support-v10-0-ce3b9e60a588@bootlin.com> In-Reply-To: <20250530-mdb-max7360-support-v10-0-ce3b9e60a588@bootlin.com> To: Lee Jones , Rob Herring , Krzysztof Kozlowski , Conor Dooley , Kamel Bouhara , Linus Walleij , Bartosz Golaszewski , Dmitry Torokhov , =?utf-8?q?Uwe_Kleine-K=C3=B6n?= =?utf-8?q?ig?= , Michael Walle , Mark Brown , Greg Kroah-Hartman , "Rafael J. Wysocki" , Danilo Krummrich Cc: devicetree@vger.kernel.org, linux-kernel@vger.kernel.org, linux-gpio@vger.kernel.org, linux-input@vger.kernel.org, linux-pwm@vger.kernel.org, andriy.shevchenko@intel.com, =?utf-8?q?Gr=C3=A9?= =?utf-8?q?gory_Clement?= , Thomas Petazzoni , Mathieu Dubois-Briand , Andy Shevchenko X-Mailer: b4 0.14.1 X-Developer-Signature: v=1; a=ed25519-sha256; t=1748599233; l=9011; i=mathieu.dubois-briand@bootlin.com; s=20241219; h=from:subject:message-id; bh=hGsZR55OfihDnF2tEvh7g9JNQPSI7GKyZaRHC0o8rL8=; b=15oxHd/nn3jrDq3xxuihUnhdqRchR/Z9hk7dcwSjZUnoR7UyrkTudDf8RHyLbCg4KhHWuMxUl cr/64ZNvuIsDdkoZo/k211jMrCjjUozlvH5QEySfIIRaieB9ZuWJWdp X-Developer-Key: i=mathieu.dubois-briand@bootlin.com; a=ed25519; pk=1PVTmzPXfKvDwcPUzG0aqdGoKZJA3b9s+3DqRlm0Lww= X-GND-State: clean X-GND-Score: -100 X-GND-Cause: gggruggvucftvghtrhhoucdtuddrgeeffedrtddtgddvkeejvdculddtuddrgeefvddrtddtmdcutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfitefpfffkpdcuggftfghnshhusghstghrihgsvgenuceurghilhhouhhtmecufedtudenucesvcftvggtihhpihgvnhhtshculddquddttddmnecujfgurhephfffufggtgfgkfhfjgfvvefosehtjeertdertdejnecuhfhrohhmpeforghthhhivghuucffuhgsohhishdquehrihgrnhguuceomhgrthhhihgvuhdrughusghoihhsqdgsrhhirghnugessghoohhtlhhinhdrtghomheqnecuggftrfgrthhtvghrnheptdfhgeetvddvheejieehheehueetjeelkedtfeehhefgfeeglefhteegtddthfetnecukfhppedvrgdtudemtggsudegmeehheeimeejrgdttdemfehftghfmehfsgdtugemuddviedvmedvvgejieenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpedvrgdtudemtggsudegmeehheeimeejrgdttdemfehftghfmehfsgdtugemuddviedvmedvvgejiedphhgvlhhopegluddvjedrtddruddrudgnpdhmrghilhhfrhhomhepmhgrthhhihgvuhdrughusghoihhsqdgsrhhirghnugessghoohhtlhhinhdrtghomhdpnhgspghrtghpthhtohepvdegpdhrtghpthhtohepughmihhtrhihrdhtohhrohhkhhhovhesghhmrghilhdrtghomhdprhgtphhtthhopehlihhnuhigqdhkvghrnhgvlhesvhhgvghrrdhkvghrn hgvlhdrohhrghdprhgtphhtthhopehrrghfrggvlheskhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqihhnphhuthesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopehlihhnuhigqdhpfihmsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtohepghhrvghgohhrhidrtghlvghmvghnthessghoohhtlhhinhdrtghomhdprhgtphhtthhopehmfigrlhhlvgeskhgvrhhnvghlrdhorhhgpdhrtghpthhtohepuggvvhhitggvthhrvggvsehvghgvrhdrkhgvrhhnvghlrdhorhhg X-GND-Sasl: mathieu.dubois-briand@bootlin.com Add driver for Maxim Integrated MAX7360 pinctrl on the PORT pins. Pins can be used either for GPIO, PWM or rotary encoder functionalities. Signed-off-by: Mathieu Dubois-Briand Reviewed-by: Linus Walleij Reviewed-by: Andy Shevchenko --- drivers/pinctrl/Kconfig | 11 ++ drivers/pinctrl/Makefile | 1 + drivers/pinctrl/pinctrl-max7360.c | 215 ++++++++++++++++++++++++++++++++++++++ 3 files changed, 227 insertions(+) diff --git a/drivers/pinctrl/Kconfig b/drivers/pinctrl/Kconfig index 464cc9aca157..276695c7a92e 100644 --- a/drivers/pinctrl/Kconfig +++ b/drivers/pinctrl/Kconfig @@ -348,6 +348,17 @@ config PINCTRL_LPC18XX help Pinctrl driver for NXP LPC18xx/43xx System Control Unit (SCU). +config PINCTRL_MAX7360 + tristate "MAX7360 Pincontrol support" + depends on MFD_MAX7360 + select PINMUX + select GENERIC_PINCONF + help + Say Y here to enable pin control support for Maxim MAX7360 keypad + controller. + This keypad controller has 8 GPIO pins that may work as GPIO, or PWM, + or rotary encoder alternate modes. + config PINCTRL_MAX77620 tristate "MAX77620/MAX20024 Pincontrol support" depends on MFD_MAX77620 && OF diff --git a/drivers/pinctrl/Makefile b/drivers/pinctrl/Makefile index ac27e88677d1..974a179b5593 100644 --- a/drivers/pinctrl/Makefile +++ b/drivers/pinctrl/Makefile @@ -36,6 +36,7 @@ obj-$(CONFIG_PINCTRL_FALCON) += pinctrl-falcon.o obj-$(CONFIG_PINCTRL_LOONGSON2) += pinctrl-loongson2.o obj-$(CONFIG_PINCTRL_XWAY) += pinctrl-xway.o obj-$(CONFIG_PINCTRL_LPC18XX) += pinctrl-lpc18xx.o +obj-$(CONFIG_PINCTRL_MAX7360) += pinctrl-max7360.o obj-$(CONFIG_PINCTRL_MAX77620) += pinctrl-max77620.o obj-$(CONFIG_PINCTRL_MCP23S08_I2C) += pinctrl-mcp23s08_i2c.o obj-$(CONFIG_PINCTRL_MCP23S08_SPI) += pinctrl-mcp23s08_spi.o diff --git a/drivers/pinctrl/pinctrl-max7360.c b/drivers/pinctrl/pinctrl-max7360.c new file mode 100644 index 000000000000..abfaff468bad --- /dev/null +++ b/drivers/pinctrl/pinctrl-max7360.c @@ -0,0 +1,215 @@ +// SPDX-License-Identifier: GPL-2.0-only +/* + * Copyright 2025 Bootlin + * + * Author: Mathieu Dubois-Briand + */ + +#include +#include +#include +#include +#include +#include +#include +#include +#include +#include +#include + +#include +#include +#include + +#include "core.h" +#include "pinmux.h" + +struct max7360_pinctrl { + struct pinctrl_dev *pctldev; + struct pinctrl_desc pinctrl_desc; +}; + +static const struct pinctrl_pin_desc max7360_pins[] = { + PINCTRL_PIN(0, "PORT0"), + PINCTRL_PIN(1, "PORT1"), + PINCTRL_PIN(2, "PORT2"), + PINCTRL_PIN(3, "PORT3"), + PINCTRL_PIN(4, "PORT4"), + PINCTRL_PIN(5, "PORT5"), + PINCTRL_PIN(6, "PORT6"), + PINCTRL_PIN(7, "PORT7"), +}; + +static const unsigned int port0_pins[] = {0}; +static const unsigned int port1_pins[] = {1}; +static const unsigned int port2_pins[] = {2}; +static const unsigned int port3_pins[] = {3}; +static const unsigned int port4_pins[] = {4}; +static const unsigned int port5_pins[] = {5}; +static const unsigned int port6_pins[] = {6}; +static const unsigned int port7_pins[] = {7}; +static const unsigned int rotary_pins[] = {6, 7}; + +static const struct pingroup max7360_groups[] = { + PINCTRL_PINGROUP("PORT0", port0_pins, ARRAY_SIZE(port0_pins)), + PINCTRL_PINGROUP("PORT1", port1_pins, ARRAY_SIZE(port1_pins)), + PINCTRL_PINGROUP("PORT2", port2_pins, ARRAY_SIZE(port2_pins)), + PINCTRL_PINGROUP("PORT3", port3_pins, ARRAY_SIZE(port3_pins)), + PINCTRL_PINGROUP("PORT4", port4_pins, ARRAY_SIZE(port4_pins)), + PINCTRL_PINGROUP("PORT5", port5_pins, ARRAY_SIZE(port5_pins)), + PINCTRL_PINGROUP("PORT6", port6_pins, ARRAY_SIZE(port6_pins)), + PINCTRL_PINGROUP("PORT7", port7_pins, ARRAY_SIZE(port7_pins)), + PINCTRL_PINGROUP("ROTARY", rotary_pins, ARRAY_SIZE(rotary_pins)), +}; + +static int max7360_pinctrl_get_groups_count(struct pinctrl_dev *pctldev) +{ + return ARRAY_SIZE(max7360_groups); +} + +static const char *max7360_pinctrl_get_group_name(struct pinctrl_dev *pctldev, + unsigned int group) +{ + return max7360_groups[group].name; +} + +static int max7360_pinctrl_get_group_pins(struct pinctrl_dev *pctldev, + unsigned int group, + const unsigned int **pins, + unsigned int *num_pins) +{ + *pins = max7360_groups[group].pins; + *num_pins = max7360_groups[group].npins; + return 0; +} + +static const struct pinctrl_ops max7360_pinctrl_ops = { + .get_groups_count = max7360_pinctrl_get_groups_count, + .get_group_name = max7360_pinctrl_get_group_name, + .get_group_pins = max7360_pinctrl_get_group_pins, +#ifdef CONFIG_OF + .dt_node_to_map = pinconf_generic_dt_node_to_map_pin, + .dt_free_map = pinconf_generic_dt_free_map, +#endif +}; + +static const char * const simple_groups[] = { + "PORT0", "PORT1", "PORT2", "PORT3", + "PORT4", "PORT5", "PORT6", "PORT7", +}; + +static const char * const rotary_groups[] = { "ROTARY" }; + +#define MAX7360_PINCTRL_FN_GPIO 0 +#define MAX7360_PINCTRL_FN_PWM 1 +#define MAX7360_PINCTRL_FN_ROTARY 2 +static const struct pinfunction max7360_functions[] = { + [MAX7360_PINCTRL_FN_GPIO] = PINCTRL_PINFUNCTION("gpio", simple_groups, + ARRAY_SIZE(simple_groups)), + [MAX7360_PINCTRL_FN_PWM] = PINCTRL_PINFUNCTION("pwm", simple_groups, + ARRAY_SIZE(simple_groups)), + [MAX7360_PINCTRL_FN_ROTARY] = PINCTRL_PINFUNCTION("rotary", rotary_groups, + ARRAY_SIZE(rotary_groups)), +}; + +static int max7360_get_functions_count(struct pinctrl_dev *pctldev) +{ + return ARRAY_SIZE(max7360_functions); +} + +static const char *max7360_get_function_name(struct pinctrl_dev *pctldev, unsigned int selector) +{ + return max7360_functions[selector].name; +} + +static int max7360_get_function_groups(struct pinctrl_dev *pctldev, unsigned int selector, + const char * const **groups, + unsigned int * const num_groups) +{ + *groups = max7360_functions[selector].groups; + *num_groups = max7360_functions[selector].ngroups; + + return 0; +} + +static int max7360_set_mux(struct pinctrl_dev *pctldev, unsigned int selector, + unsigned int group) +{ + struct regmap *regmap = dev_get_regmap(pctldev->dev->parent, NULL); + int val; + + /* + * GPIO and PWM functions are the same: we only need to handle the + * rotary encoder function, on pins 6 and 7. + */ + if (max7360_groups[group].pins[0] >= 6) { + if (selector == MAX7360_PINCTRL_FN_ROTARY) + val = MAX7360_GPIO_CFG_RTR_EN; + else + val = 0; + + return regmap_write_bits(regmap, MAX7360_REG_GPIOCFG, MAX7360_GPIO_CFG_RTR_EN, val); + } + + return 0; +} + +static const struct pinmux_ops max7360_pmxops = { + .get_functions_count = max7360_get_functions_count, + .get_function_name = max7360_get_function_name, + .get_function_groups = max7360_get_function_groups, + .set_mux = max7360_set_mux, + .strict = true, +}; + +static int max7360_pinctrl_probe(struct platform_device *pdev) +{ + struct regmap *regmap; + struct pinctrl_desc *pd; + struct max7360_pinctrl *chip; + struct device *dev = &pdev->dev; + + regmap = dev_get_regmap(dev->parent, NULL); + if (!regmap) + return dev_err_probe(dev, -ENODEV, "Could not get parent regmap\n"); + + chip = devm_kzalloc(dev, sizeof(*chip), GFP_KERNEL); + if (!chip) + return -ENOMEM; + + pd = &chip->pinctrl_desc; + + pd->pctlops = &max7360_pinctrl_ops; + pd->pmxops = &max7360_pmxops; + pd->name = dev_name(dev); + pd->pins = max7360_pins; + pd->npins = MAX7360_MAX_GPIO; + pd->owner = THIS_MODULE; + + /* + * This MFD sub-device does not have any associated device tree node: + * properties are stored in the device node of the parent (MFD) device + * and this same node is used in phandles of client devices. + * Reuse this device tree node here, as otherwise the pinctrl subsystem + * would be confused by this topology. + */ + device_set_of_node_from_dev(dev, dev->parent); + + chip->pctldev = devm_pinctrl_register(dev, pd, chip); + if (IS_ERR(chip->pctldev)) + return dev_err_probe(dev, PTR_ERR(chip->pctldev), "can't register controller\n"); + + return 0; +} + +static struct platform_driver max7360_pinctrl_driver = { + .driver = { + .name = "max7360-pinctrl", + }, + .probe = max7360_pinctrl_probe, +}; +module_platform_driver(max7360_pinctrl_driver); + +MODULE_DESCRIPTION("MAX7360 pinctrl driver"); +MODULE_AUTHOR("Mathieu Dubois-Briand "); +MODULE_LICENSE("GPL"); From patchwork Fri May 30 10:00:13 2025 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 7bit X-Patchwork-Submitter: Mathieu Dubois-Briand X-Patchwork-Id: 893768 Received: from relay7-d.mail.gandi.net (relay7-d.mail.gandi.net [217.70.183.200]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by smtp.subspace.kernel.org (Postfix) with ESMTPS id 1C3C42236E9; Fri, 30 May 2025 10:00:41 +0000 (UTC) Authentication-Results: smtp.subspace.kernel.org; arc=none smtp.client-ip=217.70.183.200 ARC-Seal: i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1748599244; cv=none; b=GTYVg82YALyk1YJ+3MEpH0Y+mZSYzzH2VlGUvcPebZJXcpJwRBF24BOJNgrhjgL8ACeELuKMHCM9YzRFkN35Gj312F3VyDLgxaponhMsZZraqVlaPmDguf4oBOhoUIoPUg8eiWhBHgCzehJ+G9DHSsFhNe3NTUfpdVcHI9S6lSc= ARC-Message-Signature: i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1748599244; c=relaxed/simple; bh=4L9hpmaLOpRRn8v3HK8FFwF4ksgoZFdcvIRZvr15JLA=; h=From:Date:Subject:MIME-Version:Content-Type:Message-Id:References: In-Reply-To:To:Cc; b=mbdQq2oFQzd/AOtJreIYPsUAFUn3WOUbn4XHyU1027nZinQWULLG3D/BFGDINvUTbSWjNUtfE760P2kI1qI7IXhPiUJHrJuGvrFmuXcxEvrZrbbmrtFRWjdrmZr1+p6w5hWMqavFAy4Wt2AN76mF3yBAt4CBdOpyCmughAB2M+M= ARC-Authentication-Results: i=1; smtp.subspace.kernel.org; dmarc=pass (p=reject dis=none) header.from=bootlin.com; spf=pass smtp.mailfrom=bootlin.com; dkim=pass (2048-bit key) header.d=bootlin.com header.i=@bootlin.com header.b=naUq27k7; arc=none smtp.client-ip=217.70.183.200 Authentication-Results: smtp.subspace.kernel.org; dmarc=pass (p=reject dis=none) header.from=bootlin.com Authentication-Results: smtp.subspace.kernel.org; spf=pass smtp.mailfrom=bootlin.com Authentication-Results: smtp.subspace.kernel.org; dkim=pass (2048-bit key) header.d=bootlin.com header.i=@bootlin.com header.b="naUq27k7" Received: by mail.gandi.net (Postfix) with ESMTPSA id 43E3943964; Fri, 30 May 2025 10:00:39 +0000 (UTC) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=bootlin.com; s=gm1; t=1748599240; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:cc:mime-version:mime-version:content-type:content-type: content-transfer-encoding:content-transfer-encoding: in-reply-to:in-reply-to:references:references; bh=C07v46ZJ6NLIc5kB8z+YwuK7NIbUJJo3tiPSKaS9zbw=; b=naUq27k7fx7R09jr28faJMPj+AhEG2k/kvVUtmmkYSy/KEMXecZCHYc0Pvr0hIb2c1MbnM GgFmd+lILTky0sznO/9Mn1jQVrHszLGH9gsrxaliz7SM1mwuWjpwAKQ0cutHcBYQzosGO+ 48QGb3DBVLN3oWPJR5gEpxmo3r3pphtVcb6aBa9EHkhDY9WYlDLrLRfOhoWSA1whxPcqxO W5LefcF9icXzfAdboUEOtuE6eR1UJiwG94lwe5ftnYXAs5iS3D/nyND2FFl7RStNa8wl/t k5ASg6p8ycnB/539zvjmxldYBPD7t+ohQ1bcKSH2YOSfb1wtw6euicdh/XQyGg== From: Mathieu Dubois-Briand Date: Fri, 30 May 2025 12:00:13 +0200 Subject: [PATCH v10 05/11] regmap: irq: Add support for chips without separate IRQ status Precedence: bulk X-Mailing-List: linux-gpio@vger.kernel.org List-Id: List-Subscribe: List-Unsubscribe: MIME-Version: 1.0 Message-Id: <20250530-mdb-max7360-support-v10-5-ce3b9e60a588@bootlin.com> References: <20250530-mdb-max7360-support-v10-0-ce3b9e60a588@bootlin.com> In-Reply-To: <20250530-mdb-max7360-support-v10-0-ce3b9e60a588@bootlin.com> To: Lee Jones , Rob Herring , Krzysztof Kozlowski , Conor Dooley , Kamel Bouhara , Linus Walleij , Bartosz Golaszewski , Dmitry Torokhov , =?utf-8?q?Uwe_Kleine-K=C3=B6n?= =?utf-8?q?ig?= , Michael Walle , Mark Brown , Greg Kroah-Hartman , "Rafael J. Wysocki" , Danilo Krummrich Cc: devicetree@vger.kernel.org, linux-kernel@vger.kernel.org, linux-gpio@vger.kernel.org, linux-input@vger.kernel.org, linux-pwm@vger.kernel.org, andriy.shevchenko@intel.com, =?utf-8?q?Gr=C3=A9?= =?utf-8?q?gory_Clement?= , Thomas Petazzoni , Mathieu Dubois-Briand , Andy Shevchenko X-Mailer: b4 0.14.1 X-Developer-Signature: v=1; a=ed25519-sha256; t=1748599233; l=7655; i=mathieu.dubois-briand@bootlin.com; s=20241219; h=from:subject:message-id; bh=4L9hpmaLOpRRn8v3HK8FFwF4ksgoZFdcvIRZvr15JLA=; b=sQgosK3ecOZ1eoj+3xRryBzf80bNF2XYw2FggSEg0jdgsxlnQfXdGmnpemZ/FGOYo/vGVmu9q fpWD2UTot5cB9ObcyODg9qCMiKxIbRjL6Hx7FPDOPh+FrWttRJ9+R6F X-Developer-Key: i=mathieu.dubois-briand@bootlin.com; a=ed25519; pk=1PVTmzPXfKvDwcPUzG0aqdGoKZJA3b9s+3DqRlm0Lww= X-GND-State: clean X-GND-Score: -100 X-GND-Cause: gggruggvucftvghtrhhoucdtuddrgeeffedrtddtgddvkeejvdculddtuddrgeefvddrtddtmdcutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfitefpfffkpdcuggftfghnshhusghstghrihgsvgenuceurghilhhouhhtmecufedtudenucesvcftvggtihhpihgvnhhtshculddquddttddmnecujfgurhephfffufggtgfgkfhfjgfvvefosehtjeertdertdejnecuhfhrohhmpeforghthhhivghuucffuhgsohhishdquehrihgrnhguuceomhgrthhhihgvuhdrughusghoihhsqdgsrhhirghnugessghoohhtlhhinhdrtghomheqnecuggftrfgrthhtvghrnheptdfhgeetvddvheejieehheehueetjeelkedtfeehhefgfeeglefhteegtddthfetnecukfhppedvrgdtudemtggsudegmeehheeimeejrgdttdemfehftghfmehfsgdtugemuddviedvmedvvgejieenucevlhhushhtvghrufhiiigvpedunecurfgrrhgrmhepihhnvghtpedvrgdtudemtggsudegmeehheeimeejrgdttdemfehftghfmehfsgdtugemuddviedvmedvvgejiedphhgvlhhopegluddvjedrtddruddrudgnpdhmrghilhhfrhhomhepmhgrthhhihgvuhdrughusghoihhsqdgsrhhirghnugessghoohhtlhhinhdrtghomhdpnhgspghrtghpthhtohepvdegpdhrtghpthhtohepughmihhtrhihrdhtohhrohhkhhhovhesghhmrghilhdrtghomhdprhgtphhtthhopehlihhnuhigqdhkvghrnhgvlhesvhhgvghrrdhkvghrn hgvlhdrohhrghdprhgtphhtthhopehrrghfrggvlheskhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqihhnphhuthesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopehlihhnuhigqdhpfihmsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtohepghhrvghgohhrhidrtghlvghmvghnthessghoohhtlhhinhdrtghomhdprhgtphhtthhopehmfigrlhhlvgeskhgvrhhnvghlrdhorhhgpdhrtghpthhtohepuggvvhhitggvthhrvggvsehvghgvrhdrkhgvrhhnvghlrdhorhhg X-GND-Sasl: mathieu.dubois-briand@bootlin.com Some GPIO chips allow to rise an IRQ on GPIO level changes but do not provide an IRQ status for each separate line: only the current gpio level can be retrieved. Add support for these chips, emulating IRQ status by comparing GPIO levels with the levels during the previous interrupt. Signed-off-by: Mathieu Dubois-Briand Reviewed-by: Andy Shevchenko --- drivers/base/regmap/regmap-irq.c | 99 +++++++++++++++++++++++++++------------- include/linux/regmap.h | 3 ++ 2 files changed, 71 insertions(+), 31 deletions(-) diff --git a/drivers/base/regmap/regmap-irq.c b/drivers/base/regmap/regmap-irq.c index 6c6869188c31..45299d29fd0b 100644 --- a/drivers/base/regmap/regmap-irq.c +++ b/drivers/base/regmap/regmap-irq.c @@ -6,11 +6,13 @@ // // Author: Mark Brown +#include #include #include #include #include #include +#include #include #include #include @@ -33,6 +35,7 @@ struct regmap_irq_chip_data { void *status_reg_buf; unsigned int *main_status_buf; unsigned int *status_buf; + unsigned int *prev_status_buf; unsigned int *mask_buf; unsigned int *mask_buf_def; unsigned int *wake_buf; @@ -332,27 +335,13 @@ static inline int read_sub_irq_data(struct regmap_irq_chip_data *data, return ret; } -static irqreturn_t regmap_irq_thread(int irq, void *d) +static int read_irq_data(struct regmap_irq_chip_data *data) { - struct regmap_irq_chip_data *data = d; const struct regmap_irq_chip *chip = data->chip; struct regmap *map = data->map; int ret, i; - bool handled = false; u32 reg; - if (chip->handle_pre_irq) - chip->handle_pre_irq(chip->irq_drv_data); - - if (chip->runtime_pm) { - ret = pm_runtime_get_sync(map->dev); - if (ret < 0) { - dev_err(map->dev, "IRQ thread failed to resume: %d\n", - ret); - goto exit; - } - } - /* * Read only registers with active IRQs if the chip has 'main status * register'. Else read in the statuses, using a single bulk read if @@ -379,10 +368,8 @@ static irqreturn_t regmap_irq_thread(int irq, void *d) reg = data->get_irq_reg(data, chip->main_status, i); ret = regmap_read(map, reg, &data->main_status_buf[i]); if (ret) { - dev_err(map->dev, - "Failed to read IRQ status %d\n", - ret); - goto exit; + dev_err(map->dev, "Failed to read IRQ status %d\n", ret); + return ret; } } @@ -398,10 +385,8 @@ static irqreturn_t regmap_irq_thread(int irq, void *d) ret = read_sub_irq_data(data, b); if (ret != 0) { - dev_err(map->dev, - "Failed to read IRQ status %d\n", - ret); - goto exit; + dev_err(map->dev, "Failed to read IRQ status %d\n", ret); + return ret; } } @@ -418,9 +403,8 @@ static irqreturn_t regmap_irq_thread(int irq, void *d) data->status_reg_buf, chip->num_regs); if (ret != 0) { - dev_err(map->dev, "Failed to read IRQ status: %d\n", - ret); - goto exit; + dev_err(map->dev, "Failed to read IRQ status: %d\n", ret); + return ret; } for (i = 0; i < data->chip->num_regs; i++) { @@ -436,7 +420,7 @@ static irqreturn_t regmap_irq_thread(int irq, void *d) break; default: BUG(); - goto exit; + return -EIO; } } @@ -447,10 +431,8 @@ static irqreturn_t regmap_irq_thread(int irq, void *d) ret = regmap_read(map, reg, &data->status_buf[i]); if (ret != 0) { - dev_err(map->dev, - "Failed to read IRQ status: %d\n", - ret); - goto exit; + dev_err(map->dev, "Failed to read IRQ status: %d\n", ret); + return ret; } } } @@ -459,6 +441,42 @@ static irqreturn_t regmap_irq_thread(int irq, void *d) for (i = 0; i < data->chip->num_regs; i++) data->status_buf[i] = ~data->status_buf[i]; + return 0; +} + +static irqreturn_t regmap_irq_thread(int irq, void *d) +{ + struct regmap_irq_chip_data *data = d; + const struct regmap_irq_chip *chip = data->chip; + struct regmap *map = data->map; + int ret, i; + bool handled = false; + u32 reg; + + if (chip->handle_pre_irq) + chip->handle_pre_irq(chip->irq_drv_data); + + if (chip->runtime_pm) { + ret = pm_runtime_get_sync(map->dev); + if (ret < 0) { + dev_err(map->dev, "IRQ thread failed to resume: %d\n", ret); + goto exit; + } + } + + ret = read_irq_data(data); + if (ret < 0) + goto exit; + + if (chip->status_is_level) { + for (i = 0; i < data->chip->num_regs; i++) { + unsigned int val = data->status_buf[i]; + + data->status_buf[i] ^= data->prev_status_buf[i]; + data->prev_status_buf[i] = val; + } + } + /* * Ignore masked IRQs and ack if we need to; we ack early so * there is no race between handling and acknowledging the @@ -705,6 +723,13 @@ int regmap_add_irq_chip_fwnode(struct fwnode_handle *fwnode, if (!d->status_buf) goto err_alloc; + if (chip->status_is_level) { + d->prev_status_buf = kcalloc(chip->num_regs, sizeof(*d->prev_status_buf), + GFP_KERNEL); + if (!d->prev_status_buf) + goto err_alloc; + } + d->mask_buf = kcalloc(chip->num_regs, sizeof(*d->mask_buf), GFP_KERNEL); if (!d->mask_buf) @@ -881,6 +906,16 @@ int regmap_add_irq_chip_fwnode(struct fwnode_handle *fwnode, } } + /* Store current levels */ + if (chip->status_is_level) { + ret = read_irq_data(d); + if (ret < 0) + goto err_alloc; + + memcpy(d->prev_status_buf, d->status_buf, + array_size(d->chip->num_regs, sizeof(d->prev_status_buf[0]))); + } + ret = regmap_irq_create_domain(fwnode, irq_base, chip, d); if (ret) goto err_alloc; @@ -908,6 +943,7 @@ int regmap_add_irq_chip_fwnode(struct fwnode_handle *fwnode, kfree(d->mask_buf); kfree(d->main_status_buf); kfree(d->status_buf); + kfree(d->prev_status_buf); kfree(d->status_reg_buf); if (d->config_buf) { for (i = 0; i < chip->num_config_bases; i++) @@ -985,6 +1021,7 @@ void regmap_del_irq_chip(int irq, struct regmap_irq_chip_data *d) kfree(d->main_status_buf); kfree(d->status_reg_buf); kfree(d->status_buf); + kfree(d->prev_status_buf); if (d->config_buf) { for (i = 0; i < d->chip->num_config_bases; i++) kfree(d->config_buf[i]); diff --git a/include/linux/regmap.h b/include/linux/regmap.h index d17c5ea3d55d..02b83f5499b8 100644 --- a/include/linux/regmap.h +++ b/include/linux/regmap.h @@ -1641,6 +1641,8 @@ struct regmap_irq_chip_data; * @ack_invert: Inverted ack register: cleared bits for ack. * @clear_ack: Use this to set 1 and 0 or vice-versa to clear interrupts. * @status_invert: Inverted status register: cleared bits are active interrupts. + * @status_is_level: Status register is actuall signal level: Xor status + * register with previous value to get active interrupts. * @wake_invert: Inverted wake register: cleared bits are wake enabled. * @type_in_mask: Use the mask registers for controlling irq type. Use this if * the hardware provides separate bits for rising/falling edge @@ -1704,6 +1706,7 @@ struct regmap_irq_chip { unsigned int ack_invert:1; unsigned int clear_ack:1; unsigned int status_invert:1; + unsigned int status_is_level:1; unsigned int wake_invert:1; unsigned int type_in_mask:1; unsigned int clear_on_unmask:1; From patchwork Fri May 30 10:00:15 2025 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 7bit X-Patchwork-Submitter: Mathieu Dubois-Briand X-Patchwork-Id: 893767 Received: from relay7-d.mail.gandi.net (relay7-d.mail.gandi.net [217.70.183.200]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by smtp.subspace.kernel.org (Postfix) with ESMTPS id D0460225A50; Fri, 30 May 2025 10:00:43 +0000 (UTC) Authentication-Results: smtp.subspace.kernel.org; arc=none smtp.client-ip=217.70.183.200 ARC-Seal: i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1748599246; cv=none; b=EZEcy9zsllfTHRonNwPF3JEpnY+RT50IiiMuTCxsZB9H5Q7DqXuVwG+FlmCEgakaqD64+9dB4kNLHy0bTVr6tXPlkeVNBL9wQnya1CkhzovWiAq1jHZ4e1VTH313/f+imoxfpvSK2l86oCqVYm+bD/XzW6glLG4LElM7BQsfaTU= ARC-Message-Signature: i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1748599246; c=relaxed/simple; bh=zir2OPwyW4bBN24qymo8eRzifRgx80iFtJEIr1HVw9E=; h=From:Date:Subject:MIME-Version:Content-Type:Message-Id:References: In-Reply-To:To:Cc; b=YI2aoHvPVkZM5XCVbJ2Rc/lFAml/2gCJaMgjKmtUnynhOO5WWbdOg0DzhEoKYLMUiIlrtJupQJkqvRJWXBggQXLs94O0qPUIzM/cYPt5rSh6R6uEYGbZ+pVFzKsjkwnHxxd85wJvWv0/8yGwrT/4Y3fDyvz2k35LcanZOuqNNT4= ARC-Authentication-Results: i=1; smtp.subspace.kernel.org; dmarc=pass (p=reject dis=none) header.from=bootlin.com; spf=pass smtp.mailfrom=bootlin.com; dkim=pass (2048-bit key) header.d=bootlin.com header.i=@bootlin.com header.b=HF/dinyv; arc=none smtp.client-ip=217.70.183.200 Authentication-Results: smtp.subspace.kernel.org; dmarc=pass (p=reject dis=none) header.from=bootlin.com Authentication-Results: smtp.subspace.kernel.org; spf=pass smtp.mailfrom=bootlin.com Authentication-Results: smtp.subspace.kernel.org; dkim=pass (2048-bit key) header.d=bootlin.com header.i=@bootlin.com header.b="HF/dinyv" Received: by mail.gandi.net (Postfix) with ESMTPSA id 60D9F438F0; Fri, 30 May 2025 10:00:41 +0000 (UTC) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=bootlin.com; s=gm1; t=1748599242; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:cc:mime-version:mime-version:content-type:content-type: content-transfer-encoding:content-transfer-encoding: in-reply-to:in-reply-to:references:references; bh=IrI+eqYF1HchsNKCg9CghNontX5ta0tdSFqHpYdIKuY=; b=HF/dinyvmhb608is2zwhu4nIwXzNj+CxgLwKJCPw3V/LPw6YcMMCcTmxiogpnr/0R43JGA tQnBWRzp1xwyy3aKN/Y8oKkwQbgQwnxtQN3+LzAigM4b5iLiChFueDg8ZYtonMYmCkfVLR bM21KbGgpSTrABRqDP6YB58CzYC8IjoH4+QoLNjDzddcdivcELGUt0oC9EwsEv0Gixx/a8 lIsE1T73XQ78hMh5P+AwnDgGh7IFuy7VzeaatmOcCmleB96P+Ja6MXh39nPmc1Y7vqN0xY waaexOc+WkgLFZoY1PIS63e5UAbrAOu4Q0cqZT5kZGHYgvZDK/uqdv/Z1VXWvA== From: Mathieu Dubois-Briand Date: Fri, 30 May 2025 12:00:15 +0200 Subject: [PATCH v10 07/11] gpio: regmap: Allow to provide init_valid_mask callback Precedence: bulk X-Mailing-List: linux-gpio@vger.kernel.org List-Id: List-Subscribe: List-Unsubscribe: MIME-Version: 1.0 Message-Id: <20250530-mdb-max7360-support-v10-7-ce3b9e60a588@bootlin.com> References: <20250530-mdb-max7360-support-v10-0-ce3b9e60a588@bootlin.com> In-Reply-To: <20250530-mdb-max7360-support-v10-0-ce3b9e60a588@bootlin.com> To: Lee Jones , Rob Herring , Krzysztof Kozlowski , Conor Dooley , Kamel Bouhara , Linus Walleij , Bartosz Golaszewski , Dmitry Torokhov , =?utf-8?q?Uwe_Kleine-K=C3=B6n?= =?utf-8?q?ig?= , Michael Walle , Mark Brown , Greg Kroah-Hartman , "Rafael J. Wysocki" , Danilo Krummrich Cc: devicetree@vger.kernel.org, linux-kernel@vger.kernel.org, linux-gpio@vger.kernel.org, linux-input@vger.kernel.org, linux-pwm@vger.kernel.org, andriy.shevchenko@intel.com, =?utf-8?q?Gr=C3=A9?= =?utf-8?q?gory_Clement?= , Thomas Petazzoni , Mathieu Dubois-Briand , Andy Shevchenko , Bartosz Golaszewski X-Mailer: b4 0.14.1 X-Developer-Signature: v=1; a=ed25519-sha256; t=1748599233; l=2233; i=mathieu.dubois-briand@bootlin.com; s=20241219; h=from:subject:message-id; bh=zir2OPwyW4bBN24qymo8eRzifRgx80iFtJEIr1HVw9E=; b=xgwB0ecBQSFTTnZ0ve9byts5csLFfVb2exkqjnG8WZnJqnk9OGl6aRwGTqKW2hnrM36mrKdZt C0jGgYYYVDBBh4xk7LjmlNJtD0cjiXjpViJAXAGATGwuGVvaG4GnOh2 X-Developer-Key: i=mathieu.dubois-briand@bootlin.com; a=ed25519; pk=1PVTmzPXfKvDwcPUzG0aqdGoKZJA3b9s+3DqRlm0Lww= X-GND-State: clean X-GND-Score: -100 X-GND-Cause: gggruggvucftvghtrhhoucdtuddrgeeffedrtddtgddvkeejvdculddtuddrgeefvddrtddtmdcutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfitefpfffkpdcuggftfghnshhusghstghrihgsvgenuceurghilhhouhhtmecufedtudenucesvcftvggtihhpihgvnhhtshculddquddttddmnecujfgurhephfffufggtgfgkfhfjgfvvefosehtjeertdertdejnecuhfhrohhmpeforghthhhivghuucffuhgsohhishdquehrihgrnhguuceomhgrthhhihgvuhdrughusghoihhsqdgsrhhirghnugessghoohhtlhhinhdrtghomheqnecuggftrfgrthhtvghrnheptdfhgeetvddvheejieehheehueetjeelkedtfeehhefgfeeglefhteegtddthfetnecukfhppedvrgdtudemtggsudegmeehheeimeejrgdttdemfehftghfmehfsgdtugemuddviedvmedvvgejieenucevlhhushhtvghrufhiiigvpedunecurfgrrhgrmhepihhnvghtpedvrgdtudemtggsudegmeehheeimeejrgdttdemfehftghfmehfsgdtugemuddviedvmedvvgejiedphhgvlhhopegluddvjedrtddruddrudgnpdhmrghilhhfrhhomhepmhgrthhhihgvuhdrughusghoihhsqdgsrhhirghnugessghoohhtlhhinhdrtghomhdpnhgspghrtghpthhtohepvdehpdhrtghpthhtohepughmihhtrhihrdhtohhrohhkhhhovhesghhmrghilhdrtghomhdprhgtphhtthhopehlihhnuhigqdhkvghrnhgvlhesvhhgvghrrdhkvghrn hgvlhdrohhrghdprhgtphhtthhopehrrghfrggvlheskhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqihhnphhuthesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopehlihhnuhigqdhpfihmsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtohepghhrvghgohhrhidrtghlvghmvghnthessghoohhtlhhinhdrtghomhdprhgtphhtthhopehmfigrlhhlvgeskhgvrhhnvghlrdhorhhgpdhrtghpthhtohepuggvvhhitggvthhrvggvsehvghgvrhdrkhgvrhhnvghlrdhorhhg X-GND-Sasl: mathieu.dubois-briand@bootlin.com Allows to populate the gpio_regmap_config structure with init_valid_mask() callback to set on the final gpio_chip structure. Reviewed-by: Michael Walle Reviewed-by: Andy Shevchenko Reviewed-by: Linus Walleij Reviewed-by: Bartosz Golaszewski Signed-off-by: Mathieu Dubois-Briand --- drivers/gpio/gpio-regmap.c | 1 + include/linux/gpio/regmap.h | 7 +++++++ 2 files changed, 8 insertions(+) diff --git a/drivers/gpio/gpio-regmap.c b/drivers/gpio/gpio-regmap.c index 039dbe70d009..cf1413fa950d 100644 --- a/drivers/gpio/gpio-regmap.c +++ b/drivers/gpio/gpio-regmap.c @@ -261,6 +261,7 @@ struct gpio_regmap *gpio_regmap_register(const struct gpio_regmap_config *config chip->names = config->names; chip->label = config->label ?: dev_name(config->parent); chip->can_sleep = regmap_might_sleep(config->regmap); + chip->init_valid_mask = config->init_valid_mask; chip->request = gpiochip_generic_request; chip->free = gpiochip_generic_free; diff --git a/include/linux/gpio/regmap.h b/include/linux/gpio/regmap.h index 19b52ac03a5d..622a2939ebe0 100644 --- a/include/linux/gpio/regmap.h +++ b/include/linux/gpio/regmap.h @@ -6,6 +6,7 @@ struct device; struct fwnode_handle; struct gpio_regmap; +struct gpio_chip; struct irq_domain; struct regmap; @@ -40,6 +41,8 @@ struct regmap; * @drvdata: (Optional) Pointer to driver specific data which is * not used by gpio-remap but is provided "as is" to the * driver callback(s). + * @init_valid_mask: (Optional) Routine to initialize @valid_mask, to be used + * if not all GPIOs are valid. * @regmap_irq_chip: (Optional) Pointer on an regmap_irq_chip structure. If * set, a regmap-irq device will be created and the IRQ * domain will be set accordingly. @@ -93,6 +96,10 @@ struct gpio_regmap_config { unsigned int offset, unsigned int *reg, unsigned int *mask); + int (*init_valid_mask)(struct gpio_chip *gc, + unsigned long *valid_mask, + unsigned int ngpios); + void *drvdata; }; From patchwork Fri May 30 10:00:17 2025 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 7bit X-Patchwork-Submitter: Mathieu Dubois-Briand X-Patchwork-Id: 893766 Received: from relay7-d.mail.gandi.net (relay7-d.mail.gandi.net [217.70.183.200]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by smtp.subspace.kernel.org (Postfix) with ESMTPS id 024B222B588; Fri, 30 May 2025 10:00:45 +0000 (UTC) Authentication-Results: smtp.subspace.kernel.org; arc=none smtp.client-ip=217.70.183.200 ARC-Seal: i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1748599249; cv=none; b=Jtg0bs21/OUJ20LxRCukmFoaKZJIELr0FbVuUAGB2n60yD0OAQo/tjUV4YO5Bon/kOhPcSXhu9XnvWcI5yGILdBIhb6lK07AzND0KKo7g/cZkqgtXhxPv9yKh21tgfuT+FJZqlcyQv1KRVOH8Qs6LAz85c6uw4aKRwkkleW2CSA= ARC-Message-Signature: i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1748599249; c=relaxed/simple; bh=JI3737qpZV5i/n/DYPnkPTfd1V/ujAG4pR1TJ/4gbgo=; h=From:Date:Subject:MIME-Version:Content-Type:Message-Id:References: In-Reply-To:To:Cc; b=fqbE2zi5Fi5OemtMKi5+yHdjAUxk+yqctMjQa2r7nAVQaU1DbToBOCvn+229ytkQ9YATB8RvuMlDbMqr58uveE0/UJlXL4uFqK5Q4P+VXInPZhlSs6rxLJdMVdZUlN4PAPRTvfzC4GWtD6rYPaNNGoUlXBFHRa2+ikJrK4bEoxs= ARC-Authentication-Results: i=1; smtp.subspace.kernel.org; dmarc=pass (p=reject dis=none) header.from=bootlin.com; spf=pass smtp.mailfrom=bootlin.com; dkim=pass (2048-bit key) header.d=bootlin.com header.i=@bootlin.com header.b=lEXiJPs0; arc=none smtp.client-ip=217.70.183.200 Authentication-Results: smtp.subspace.kernel.org; dmarc=pass (p=reject dis=none) header.from=bootlin.com Authentication-Results: smtp.subspace.kernel.org; spf=pass smtp.mailfrom=bootlin.com Authentication-Results: smtp.subspace.kernel.org; dkim=pass (2048-bit key) header.d=bootlin.com header.i=@bootlin.com header.b="lEXiJPs0" Received: by mail.gandi.net (Postfix) with ESMTPSA id 8BAFE4396B; Fri, 30 May 2025 10:00:43 +0000 (UTC) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=bootlin.com; s=gm1; t=1748599244; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:cc:mime-version:mime-version:content-type:content-type: content-transfer-encoding:content-transfer-encoding: in-reply-to:in-reply-to:references:references; bh=uGf57HS6QUeaCcFUW+/oTiK0us3RHmT+M6Av6twgbrQ=; b=lEXiJPs0g78O63YUJ7G0Vym1875igERBBzOQxLyCRXjiS96I04+aaiAn/1K0TPeIMp1BpA i+Y4NRTe30XvpqMx01UW1h3mxNnjPR1MX5QrsQHL5BhqY5BkuPsF6SBOeOVSjnwtOaOwea +vdYYJMgwUvxIE01671MGoLuk0jIIpvAH2QAQ7NV/0z/bWIzVg5hm0fMrVCoTndYOKekJK ES4Nyzl863lWn9Q/XUDggEItPlBfBYCqqrdzWXNEV5VbFMbgFzBlmdqd6q1Q1O1nHbm5N2 G6hkLLGbqHiN3FkQeJS2UmOka4bzHbBtlOELLcdyDchNzGzNPaH05krWMxe+eg== From: Mathieu Dubois-Briand Date: Fri, 30 May 2025 12:00:17 +0200 Subject: [PATCH v10 09/11] input: keyboard: Add support for MAX7360 keypad Precedence: bulk X-Mailing-List: linux-gpio@vger.kernel.org List-Id: List-Subscribe: List-Unsubscribe: MIME-Version: 1.0 Message-Id: <20250530-mdb-max7360-support-v10-9-ce3b9e60a588@bootlin.com> References: <20250530-mdb-max7360-support-v10-0-ce3b9e60a588@bootlin.com> In-Reply-To: <20250530-mdb-max7360-support-v10-0-ce3b9e60a588@bootlin.com> To: Lee Jones , Rob Herring , Krzysztof Kozlowski , Conor Dooley , Kamel Bouhara , Linus Walleij , Bartosz Golaszewski , Dmitry Torokhov , =?utf-8?q?Uwe_Kleine-K=C3=B6n?= =?utf-8?q?ig?= , Michael Walle , Mark Brown , Greg Kroah-Hartman , "Rafael J. Wysocki" , Danilo Krummrich Cc: devicetree@vger.kernel.org, linux-kernel@vger.kernel.org, linux-gpio@vger.kernel.org, linux-input@vger.kernel.org, linux-pwm@vger.kernel.org, andriy.shevchenko@intel.com, =?utf-8?q?Gr=C3=A9?= =?utf-8?q?gory_Clement?= , Thomas Petazzoni , Mathieu Dubois-Briand X-Mailer: b4 0.14.1 X-Developer-Signature: v=1; a=ed25519-sha256; t=1748599233; l=11626; i=mathieu.dubois-briand@bootlin.com; s=20241219; h=from:subject:message-id; bh=JI3737qpZV5i/n/DYPnkPTfd1V/ujAG4pR1TJ/4gbgo=; b=YgBjVkbUIiaXeh4IexaCgk6ehMEehw/uKSGdCrpTDEUmR+L4ZNxcKORrYSGKxUmDxOhX8ya8/ xF0LKf6bhW8BgrXB1Iz7S12LsIH0gjBsRiWUCoc5SekkUS2CUw59OxT X-Developer-Key: i=mathieu.dubois-briand@bootlin.com; a=ed25519; pk=1PVTmzPXfKvDwcPUzG0aqdGoKZJA3b9s+3DqRlm0Lww= X-GND-State: clean X-GND-Score: -100 X-GND-Cause: gggruggvucftvghtrhhoucdtuddrgeeffedrtddtgddvkeejvdculddtuddrgeefvddrtddtmdcutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfitefpfffkpdcuggftfghnshhusghstghrihgsvgenuceurghilhhouhhtmecufedtudenucesvcftvggtihhpihgvnhhtshculddquddttddmnecujfgurhephfffufggtgfgkfhfjgfvvefosehtjeertdertdejnecuhfhrohhmpeforghthhhivghuucffuhgsohhishdquehrihgrnhguuceomhgrthhhihgvuhdrughusghoihhsqdgsrhhirghnugessghoohhtlhhinhdrtghomheqnecuggftrfgrthhtvghrnheptdfhgeetvddvheejieehheehueetjeelkedtfeehhefgfeeglefhteegtddthfetnecukfhppedvrgdtudemtggsudegmeehheeimeejrgdttdemfehftghfmehfsgdtugemuddviedvmedvvgejieenucevlhhushhtvghrufhiiigvpedunecurfgrrhgrmhepihhnvghtpedvrgdtudemtggsudegmeehheeimeejrgdttdemfehftghfmehfsgdtugemuddviedvmedvvgejiedphhgvlhhopegluddvjedrtddruddrudgnpdhmrghilhhfrhhomhepmhgrthhhihgvuhdrughusghoihhsqdgsrhhirghnugessghoohhtlhhinhdrtghomhdpnhgspghrtghpthhtohepvdefpdhrtghpthhtohepughmihhtrhihrdhtohhrohhkhhhovhesghhmrghilhdrtghomhdprhgtphhtthhopehlihhnuhigqdhkvghrnhgvlhesvhhgvghrrdhkvghrn hgvlhdrohhrghdprhgtphhtthhopehrrghfrggvlheskhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqihhnphhuthesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopehlihhnuhigqdhpfihmsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtohepghhrvghgohhrhidrtghlvghmvghnthessghoohhtlhhinhdrtghomhdprhgtphhtthhopehmfigrlhhlvgeskhgvrhhnvghlrdhorhhgpdhrtghpthhtohepuggvvhhitggvthhrvggvsehvghgvrhdrkhgvrhhnvghlrdhorhhg X-GND-Sasl: mathieu.dubois-briand@bootlin.com Add driver for Maxim Integrated MAX7360 keypad controller, providing support for up to 64 keys, with a matrix of 8 columns and 8 rows. Signed-off-by: Mathieu Dubois-Briand --- drivers/input/keyboard/Kconfig | 12 ++ drivers/input/keyboard/Makefile | 1 + drivers/input/keyboard/max7360-keypad.c | 308 ++++++++++++++++++++++++++++++++ 3 files changed, 321 insertions(+) diff --git a/drivers/input/keyboard/Kconfig b/drivers/input/keyboard/Kconfig index 721ab69e84ac..93b5cccf6892 100644 --- a/drivers/input/keyboard/Kconfig +++ b/drivers/input/keyboard/Kconfig @@ -421,6 +421,18 @@ config KEYBOARD_MAX7359 To compile this driver as a module, choose M here: the module will be called max7359_keypad. +config KEYBOARD_MAX7360 + tristate "Maxim MAX7360 Key Switch Controller" + select INPUT_MATRIXKMAP + depends on I2C + depends on MFD_MAX7360 + help + If you say yes here you get support for the keypad controller on the + Maxim MAX7360 I/O Expander. + + To compile this driver as a module, choose M here: the module will be + called max7360_keypad. + config KEYBOARD_MPR121 tristate "Freescale MPR121 Touchkey" depends on I2C diff --git a/drivers/input/keyboard/Makefile b/drivers/input/keyboard/Makefile index 1e0721c30709..b49d32d4003d 100644 --- a/drivers/input/keyboard/Makefile +++ b/drivers/input/keyboard/Makefile @@ -42,6 +42,7 @@ obj-$(CONFIG_KEYBOARD_LPC32XX) += lpc32xx-keys.o obj-$(CONFIG_KEYBOARD_MAPLE) += maple_keyb.o obj-$(CONFIG_KEYBOARD_MATRIX) += matrix_keypad.o obj-$(CONFIG_KEYBOARD_MAX7359) += max7359_keypad.o +obj-$(CONFIG_KEYBOARD_MAX7360) += max7360-keypad.o obj-$(CONFIG_KEYBOARD_MPR121) += mpr121_touchkey.o obj-$(CONFIG_KEYBOARD_MT6779) += mt6779-keypad.o obj-$(CONFIG_KEYBOARD_MTK_PMIC) += mtk-pmic-keys.o diff --git a/drivers/input/keyboard/max7360-keypad.c b/drivers/input/keyboard/max7360-keypad.c new file mode 100644 index 000000000000..6bae00e7888b --- /dev/null +++ b/drivers/input/keyboard/max7360-keypad.c @@ -0,0 +1,308 @@ +// SPDX-License-Identifier: GPL-2.0-only +/* + * Copyright 2025 Bootlin + * + * Author: Mathieu Dubois-Briand + */ + +#include +#include +#include +#include +#include +#include +#include +#include +#include +#include +#include +#include +#include +#include +#include +#include +#include + +struct max7360_keypad { + struct input_dev *input; + unsigned int rows; + unsigned int cols; + unsigned int debounce_ms; + int irq; + struct regmap *regmap; + unsigned short keycodes[MAX7360_MAX_KEY_ROWS * MAX7360_MAX_KEY_COLS]; +}; + +static irqreturn_t max7360_keypad_irq(int irq, void *data) +{ + struct max7360_keypad *max7360_keypad = data; + struct device *dev = max7360_keypad->input->dev.parent; + unsigned int val; + unsigned int row, col; + unsigned int release; + unsigned int code; + int error; + + error = regmap_read(max7360_keypad->regmap, MAX7360_REG_KEYFIFO, &val); + if (error) { + dev_err(dev, "Failed to read MAX7360 FIFO"); + return IRQ_NONE; + } + + /* FIFO overflow: ignore it and get next event. */ + if (val == MAX7360_FIFO_OVERFLOW) { + dev_warn(dev, "max7360 FIFO overflow"); + error = regmap_read_poll_timeout(max7360_keypad->regmap, MAX7360_REG_KEYFIFO, + val, val != MAX7360_FIFO_OVERFLOW, 0, 1000); + if (error) { + dev_err(dev, "Failed to empty MAX7360 FIFO"); + return IRQ_NONE; + } + } + + if (val == MAX7360_FIFO_EMPTY) { + dev_dbg(dev, "Got a spurious interrupt"); + + return IRQ_NONE; + } + + row = FIELD_GET(MAX7360_FIFO_ROW, val); + col = FIELD_GET(MAX7360_FIFO_COL, val); + release = val & MAX7360_FIFO_RELEASE; + + code = MATRIX_SCAN_CODE(row, col, get_count_order(max7360_keypad->cols)); + + dev_dbg(dev, "key[%d:%d] %s\n", row, col, release ? "release" : "press"); + + input_event(max7360_keypad->input, EV_MSC, MSC_SCAN, code); + input_report_key(max7360_keypad->input, max7360_keypad->keycodes[code], !release); + input_sync(max7360_keypad->input); + + return IRQ_HANDLED; +} + +static int max7360_keypad_open(struct input_dev *pdev) +{ + struct max7360_keypad *max7360_keypad = input_get_drvdata(pdev); + struct device *dev = max7360_keypad->input->dev.parent; + int error; + + /* Somebody is using the device: get out of sleep. */ + error = regmap_write_bits(max7360_keypad->regmap, MAX7360_REG_CONFIG, + MAX7360_CFG_SLEEP, MAX7360_CFG_SLEEP); + if (error) + dev_err(dev, "Failed to write max7360 configuration: %d\n", error); + + return error; +} + +static void max7360_keypad_close(struct input_dev *pdev) +{ + struct max7360_keypad *max7360_keypad = input_get_drvdata(pdev); + struct device *dev = max7360_keypad->input->dev.parent; + int error; + + /* Nobody is using the device anymore: go to sleep. */ + error = regmap_write_bits(max7360_keypad->regmap, MAX7360_REG_CONFIG, MAX7360_CFG_SLEEP, 0); + if (error) + dev_err(dev, "Failed to write max7360 configuration: %d\n", error); +} + +static int max7360_keypad_hw_init(struct max7360_keypad *max7360_keypad) +{ + struct device *dev = max7360_keypad->input->dev.parent; + unsigned int val; + int error; + + val = max7360_keypad->debounce_ms - MAX7360_DEBOUNCE_MIN; + error = regmap_write_bits(max7360_keypad->regmap, MAX7360_REG_DEBOUNCE, + MAX7360_DEBOUNCE, + FIELD_PREP(MAX7360_DEBOUNCE, val)); + if (error) + return dev_err_probe(dev, error, + "Failed to write max7360 debounce configuration\n"); + + error = regmap_write_bits(max7360_keypad->regmap, MAX7360_REG_INTERRUPT, + MAX7360_INTERRUPT_TIME_MASK, + FIELD_PREP(MAX7360_INTERRUPT_TIME_MASK, 1)); + if (error) + return dev_err_probe(dev, error, + "Failed to write max7360 keypad interrupt configuration\n"); + + return 0; +} + +static int max7360_keypad_build_keymap(struct max7360_keypad *max7360_keypad) +{ + struct input_dev *input_dev = max7360_keypad->input; + struct device *dev = input_dev->dev.parent->parent; + struct matrix_keymap_data keymap_data; + const char *propname = "linux,keymap"; + unsigned int max_keys; + int error; + int size; + + size = device_property_count_u32(dev, propname); + if (size <= 0) { + dev_err(dev, "missing or malformed property %s: %d\n", propname, size); + return size < 0 ? size : -EINVAL; + } + + max_keys = max7360_keypad->cols * max7360_keypad->rows; + if (size > max_keys) { + dev_err(dev, "%s size overflow (%d vs max %u)\n", propname, size, max_keys); + return -EINVAL; + } + + u32 *keys __free(kfree) = kmalloc_array(size, sizeof(*keys), GFP_KERNEL); + if (!keys) + return -ENOMEM; + + error = device_property_read_u32_array(dev, propname, keys, size); + if (error) { + dev_err(dev, "failed to read %s property: %d\n", propname, error); + return error; + } + + keymap_data.keymap = keys; + keymap_data.keymap_size = size; + error = matrix_keypad_build_keymap(&keymap_data, NULL, + max7360_keypad->rows, max7360_keypad->cols, + max7360_keypad->keycodes, max7360_keypad->input); + if (error) + return error; + + return 0; +} + +static int max7360_keypad_parse_fw(struct device *dev, + struct max7360_keypad *max7360_keypad, + bool *autorepeat) +{ + int error; + + error = matrix_keypad_parse_properties(dev->parent, &max7360_keypad->rows, + &max7360_keypad->cols); + if (error) + return error; + + if (!max7360_keypad->rows || !max7360_keypad->cols || + max7360_keypad->rows > MAX7360_MAX_KEY_ROWS || + max7360_keypad->cols > MAX7360_MAX_KEY_COLS) { + dev_err(dev, "Invalid number of columns or rows (%ux%u)\n", + max7360_keypad->cols, max7360_keypad->rows); + return -EINVAL; + } + + *autorepeat = device_property_read_bool(dev->parent, "autorepeat"); + + max7360_keypad->debounce_ms = MAX7360_DEBOUNCE_MIN; + error = device_property_read_u32(dev->parent, "keypad-debounce-delay-ms", + &max7360_keypad->debounce_ms); + if (error == -EINVAL) { + dev_info(dev, "Using default keypad-debounce-delay-ms: %u\n", + max7360_keypad->debounce_ms); + } else if (error < 0) { + dev_err(dev, "Failed to read keypad-debounce-delay-ms property\n"); + return error; + } + + if (!in_range(max7360_keypad->debounce_ms, MAX7360_DEBOUNCE_MIN, + MAX7360_DEBOUNCE_MAX - MAX7360_DEBOUNCE_MIN)) { + dev_err(dev, "Invalid keypad-debounce-delay-ms: %u, should be between %u and %u.\n", + max7360_keypad->debounce_ms, MAX7360_DEBOUNCE_MIN, MAX7360_DEBOUNCE_MAX); + return -EINVAL; + } + + return 0; +} + +static int max7360_keypad_probe(struct platform_device *pdev) +{ + struct max7360_keypad *max7360_keypad; + struct device *dev = &pdev->dev; + struct input_dev *input; + struct regmap *regmap; + bool autorepeat; + int error; + int irq; + + regmap = dev_get_regmap(dev->parent, NULL); + if (!regmap) + return dev_err_probe(dev, -ENODEV, "Could not get parent regmap\n"); + + irq = fwnode_irq_get_byname(dev_fwnode(dev->parent), "intk"); + if (irq < 0) + return dev_err_probe(dev, irq, "Failed to get IRQ\n"); + + max7360_keypad = devm_kzalloc(dev, sizeof(*max7360_keypad), GFP_KERNEL); + if (!max7360_keypad) + return -ENOMEM; + + max7360_keypad->regmap = regmap; + + error = max7360_keypad_parse_fw(dev, max7360_keypad, &autorepeat); + if (error) + return error; + + input = devm_input_allocate_device(dev); + if (!input) + return -ENOMEM; + + max7360_keypad->input = input; + + input->id.bustype = BUS_I2C; + input->name = pdev->name; + input->open = max7360_keypad_open; + input->close = max7360_keypad_close; + + error = max7360_keypad_build_keymap(max7360_keypad); + if (error) + return dev_err_probe(dev, error, "Failed to build keymap\n"); + + input_set_capability(input, EV_MSC, MSC_SCAN); + if (autorepeat) + __set_bit(EV_REP, input->evbit); + + input_set_drvdata(input, max7360_keypad); + + error = devm_request_threaded_irq(dev, irq, NULL, max7360_keypad_irq, + IRQF_ONESHOT, + "max7360-keypad", max7360_keypad); + if (error) + return dev_err_probe(dev, error, "Failed to register interrupt\n"); + + error = input_register_device(input); + if (error) + return dev_err_probe(dev, error, "Could not register input device\n"); + + error = max7360_keypad_hw_init(max7360_keypad); + if (error) + return dev_err_probe(dev, error, "Failed to initialize max7360 keypad\n"); + + device_init_wakeup(dev, true); + error = dev_pm_set_wake_irq(dev, irq); + if (error) + dev_warn(dev, "Failed to set up wakeup irq: %d\n", error); + + return 0; +} + +static void max7360_keypad_remove(struct platform_device *pdev) +{ + dev_pm_clear_wake_irq(&pdev->dev); + device_init_wakeup(&pdev->dev, false); +} + +static struct platform_driver max7360_keypad_driver = { + .driver = { + .name = "max7360-keypad", + }, + .probe = max7360_keypad_probe, + .remove = max7360_keypad_remove, +}; +module_platform_driver(max7360_keypad_driver); + +MODULE_DESCRIPTION("MAX7360 Keypad driver"); +MODULE_AUTHOR("Mathieu Dubois-Briand "); +MODULE_LICENSE("GPL"); From patchwork Fri May 30 10:00:19 2025 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 7bit X-Patchwork-Submitter: Mathieu Dubois-Briand X-Patchwork-Id: 893765 Received: from relay7-d.mail.gandi.net (relay7-d.mail.gandi.net [217.70.183.200]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by smtp.subspace.kernel.org (Postfix) with ESMTPS id C9DEB22CBE4; Fri, 30 May 2025 10:00:47 +0000 (UTC) Authentication-Results: smtp.subspace.kernel.org; arc=none smtp.client-ip=217.70.183.200 ARC-Seal: i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1748599250; cv=none; b=qqitqPcQj7HBpXPFtYfabONicNL713LjQSH5YV+A5hDlfHz6A090b7+H2fTTzSZrVjww7YRRqj9UOFAXaGyAWKlu2QYEKfW7G5LG5NMuv2bO1VkLt2WfSi54nMATzlf03AMcQeDaR+oE5bz1D41/DJIbM4Z23LNeDGkB8IDhdPk= ARC-Message-Signature: i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1748599250; c=relaxed/simple; bh=x49V9flGjW5Iu+dDUMbF+Bj1EHJSN31k2XSNzCDdeY0=; h=From:Date:Subject:MIME-Version:Content-Type:Message-Id:References: In-Reply-To:To:Cc; b=IugJubkEV3BlfKlTnirhqn+RXeCJA/nvCxqbc5irfOYoO0uHDlPI1NWrtBaDfRg4iyTRHtH9Xjngs9VhXt4sP3IwaHEdhtTuOZoEriAX6+MzkM3YgLUeMW5415i5eX5L7l4nBd58VagK4Ls11t7DZm4fe+7KAwNksKRlaBLdfW4= ARC-Authentication-Results: i=1; smtp.subspace.kernel.org; dmarc=pass (p=reject dis=none) header.from=bootlin.com; spf=pass smtp.mailfrom=bootlin.com; dkim=pass (2048-bit key) header.d=bootlin.com header.i=@bootlin.com header.b=hjrf3tSB; arc=none smtp.client-ip=217.70.183.200 Authentication-Results: smtp.subspace.kernel.org; dmarc=pass (p=reject dis=none) header.from=bootlin.com Authentication-Results: smtp.subspace.kernel.org; spf=pass smtp.mailfrom=bootlin.com Authentication-Results: smtp.subspace.kernel.org; dkim=pass (2048-bit key) header.d=bootlin.com header.i=@bootlin.com header.b="hjrf3tSB" Received: by mail.gandi.net (Postfix) with ESMTPSA id 8B6F943964; Fri, 30 May 2025 10:00:45 +0000 (UTC) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=bootlin.com; s=gm1; t=1748599246; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:cc:mime-version:mime-version:content-type:content-type: content-transfer-encoding:content-transfer-encoding: in-reply-to:in-reply-to:references:references; bh=+SaAor8RJ9fcZauI+iZmsMhtCP5POL3MPW2thUkrwYA=; b=hjrf3tSBfXqg3CcnfvoiW9YpjzJi1e6ZxEulb9YRHCgNrkLvX5J4rLVQgxptzu42YdGpBQ no1HM8WR8iSQqKQYdf72C0mmFGhjCPKU4yw550sygYCHSGSCAlJ9ZgV77VBmqce9ycgitL PHrEtHN2dP31ydeHl75G4sJc5z0XvKIdVF9P8kplVLVpTUz0LcL8xRIsO6N8SgPoOHW2YC HyYWpW8vseRUF+mGGYltMP/2zXkR0uBquMwzbUL6nD89h6weIiy2s1uVIVqu12CZO75KrG OfVlLepJb1rm/3KDQ8H+D/jVgKEeJCt5umO9YwzfWPs+oyX5YapmR0Nw+C1bvQ== From: Mathieu Dubois-Briand Date: Fri, 30 May 2025 12:00:19 +0200 Subject: [PATCH v10 11/11] MAINTAINERS: Add entry on MAX7360 driver Precedence: bulk X-Mailing-List: linux-gpio@vger.kernel.org List-Id: List-Subscribe: List-Unsubscribe: MIME-Version: 1.0 Message-Id: <20250530-mdb-max7360-support-v10-11-ce3b9e60a588@bootlin.com> References: <20250530-mdb-max7360-support-v10-0-ce3b9e60a588@bootlin.com> In-Reply-To: <20250530-mdb-max7360-support-v10-0-ce3b9e60a588@bootlin.com> To: Lee Jones , Rob Herring , Krzysztof Kozlowski , Conor Dooley , Kamel Bouhara , Linus Walleij , Bartosz Golaszewski , Dmitry Torokhov , =?utf-8?q?Uwe_Kleine-K=C3=B6n?= =?utf-8?q?ig?= , Michael Walle , Mark Brown , Greg Kroah-Hartman , "Rafael J. Wysocki" , Danilo Krummrich Cc: devicetree@vger.kernel.org, linux-kernel@vger.kernel.org, linux-gpio@vger.kernel.org, linux-input@vger.kernel.org, linux-pwm@vger.kernel.org, andriy.shevchenko@intel.com, =?utf-8?q?Gr=C3=A9?= =?utf-8?q?gory_Clement?= , Thomas Petazzoni , Mathieu Dubois-Briand X-Mailer: b4 0.14.1 X-Developer-Signature: v=1; a=ed25519-sha256; t=1748599233; l=1082; i=mathieu.dubois-briand@bootlin.com; s=20241219; h=from:subject:message-id; bh=x49V9flGjW5Iu+dDUMbF+Bj1EHJSN31k2XSNzCDdeY0=; b=yNe0ZQ7IO7beptB66N3BeQX1GJYe+SQ1Ddyuruc6aL5vYPvPshTZaLwmvv/ydeOQcsWFN+wtn ru8ekwt/DtmALxaAA0TzjqvoEwn7CGr1V/LokfTTg/PUpPSG9lTv0OP X-Developer-Key: i=mathieu.dubois-briand@bootlin.com; a=ed25519; pk=1PVTmzPXfKvDwcPUzG0aqdGoKZJA3b9s+3DqRlm0Lww= X-GND-State: clean X-GND-Score: -100 X-GND-Cause: gggruggvucftvghtrhhoucdtuddrgeeffedrtddtgddvkeejvdculddtuddrgeefvddrtddtmdcutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfitefpfffkpdcuggftfghnshhusghstghrihgsvgenuceurghilhhouhhtmecufedtudenucesvcftvggtihhpihgvnhhtshculddquddttddmnecujfgurhephfffufggtgfgkfhfjgfvvefosehtjeertdertdejnecuhfhrohhmpeforghthhhivghuucffuhgsohhishdquehrihgrnhguuceomhgrthhhihgvuhdrughusghoihhsqdgsrhhirghnugessghoohhtlhhinhdrtghomheqnecuggftrfgrthhtvghrnheptdfhgeetvddvheejieehheehueetjeelkedtfeehhefgfeeglefhteegtddthfetnecukfhppedvrgdtudemtggsudegmeehheeimeejrgdttdemfehftghfmehfsgdtugemuddviedvmedvvgejieenucevlhhushhtvghrufhiiigvpeejnecurfgrrhgrmhepihhnvghtpedvrgdtudemtggsudegmeehheeimeejrgdttdemfehftghfmehfsgdtugemuddviedvmedvvgejiedphhgvlhhopegluddvjedrtddruddrudgnpdhmrghilhhfrhhomhepmhgrthhhihgvuhdrughusghoihhsqdgsrhhirghnugessghoohhtlhhinhdrtghomhdpnhgspghrtghpthhtohepvdefpdhrtghpthhtohepughmihhtrhihrdhtohhrohhkhhhovhesghhmrghilhdrtghomhdprhgtphhtthhopehlihhnuhigqdhkvghrnhgvlhesvhhgvghrrdhkvghrn hgvlhdrohhrghdprhgtphhtthhopehrrghfrggvlheskhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqihhnphhuthesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopehlihhnuhigqdhpfihmsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtohepghhrvghgohhrhidrtghlvghmvghnthessghoohhtlhhinhdrtghomhdprhgtphhtthhopehmfigrlhhlvgeskhgvrhhnvghlrdhorhhgpdhrtghpthhtohepuggvvhhitggvthhrvggvsehvghgvrhdrkhgvrhhnvghlrdhorhhg X-GND-Sasl: mathieu.dubois-briand@bootlin.com Add myself as maintainer of Maxim MAX7360 driver and device-tree bindings. Signed-off-by: Mathieu Dubois-Briand --- MAINTAINERS | 13 +++++++++++++ 1 file changed, 13 insertions(+) diff --git a/MAINTAINERS b/MAINTAINERS index dd844ac8d910..905ae71aed91 100644 --- a/MAINTAINERS +++ b/MAINTAINERS @@ -14592,6 +14592,19 @@ L: linux-iio@vger.kernel.org S: Maintained F: drivers/iio/temperature/max30208.c +MAXIM MAX7360 KEYPAD LED MFD DRIVER +M: Mathieu Dubois-Briand +S: Maintained +F: Documentation/devicetree/bindings/gpio/maxim,max7360-gpio.yaml +F: Documentation/devicetree/bindings/mfd/maxim,max7360.yaml +F: drivers/gpio/gpio-max7360.c +F: drivers/input/keyboard/max7360-keypad.c +F: drivers/input/misc/max7360-rotary.c +F: drivers/mfd/max7360.c +F: drivers/pinctrl/pinctrl-max7360.c +F: drivers/pwm/pwm-max7360.c +F: include/linux/mfd/max7360.h + MAXIM MAX77650 PMIC MFD DRIVER M: Bartosz Golaszewski L: linux-kernel@vger.kernel.org